StarFunc result for job id Q8NFZ8

User Input

>input (388 residues)
MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPA
RQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTV
LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSV
ASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDT
LVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHA
RALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEA
SGLDEQGEAREAFLNGSDGHKRKEEFFI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NFZ8	1.000	1.000	1.205E-69	388	1.000	1.000	Q8NFZ8.pdb.gz	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
2	AFDB:F1QF23	0.748	0.742	8.687E-50	391	0.588	0.583	F1QF23.pdb.gz
3	AFDB:B0CLV3	0.734	0.691	5.189E-49	413	0.585	0.550	B0CLV3.pdb.gz	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
4	AFDB:Q8R5M8	0.620	0.538	2.520E-37	456	0.376	0.320	Q8R5M8.pdb.gz	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
5	AFDB:Q6PFK4	0.642	0.620	4.350E-37	405	0.358	0.343	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
6	AFDB:Q6AYP5	0.645	0.536	7.147E-37	476	0.374	0.305	Q6AYP5.pdb.gz	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
7	AFDB:B0CLV6	0.631	0.588	4.403E-35	420	0.345	0.319	B0CLV6.pdb.gz	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
8	AFDB:Q1WIM2	0.633	0.572	5.643E-35	435	0.374	0.333	Q1WIM2.pdb.gz	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
9	AFDB:Q8N126	0.602	0.589	1.288E-33	398	0.351	0.342	Q8N126.pdb.gz	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
10	AFDB:Q15223	0.577	0.449	9.545E-26	517	0.232	0.174	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
11	PDB:6dldD	0.478	0.648	5.999E-16	269	0.165	0.238	6dldD.pdb.gz
12	PDB:6dlfA	0.471	0.732	7.180E-15	236	0.155	0.254	6dlfA.pdb.gz
13	PDB:5oj2B	0.349	0.208	2.692E-13	692	0.155	0.087	5oj2B.pdb.gz
14	PDB:1e07A	0.363	0.245	2.023E-11	642	0.152	0.092	1e07A.pdb.gz
15	PDB:3u7wL	0.247	0.408	5.196E-11	210	0.108	0.200	3u7wL.pdb.gz
16	PDB:2ajsL	0.255	0.406	6.337E-11	216	0.119	0.213	2ajsL.pdb.gz	Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
17	PDB:5c7kF	0.263	0.409	6.659E-11	212	0.108	0.198	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
18	PDB:1q0xL	0.257	0.426	8.122E-11	212	0.103	0.189	1q0xL.pdb.gz
19	PDB:4ydvL	0.244	0.408	1.474E-10	206	0.093	0.175	4ydvL.pdb.gz	Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
20	PDB:2rcjC	0.258	0.208	1.549E-10	523	0.155	0.115	2rcjC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NFZ8	0.0	797	388	1.000	1.000	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
2	Q8R464	0.0	788	388	0.985	0.985	CADM4_MOUSE Cell adhesion molecule 4 OS=Mus musculus OX=10090 GN=Cadm4 PE=1 SV=1
3	Q5U3R8	5.30e-160	456	389	0.580	0.578	Q5U3R8_DANRE Cadm4 protein OS=Danio rerio OX=7955 GN=zgc:101704 PE=2 SV=1
4	B0CLV3	2.49e-155	446	413	0.580	0.545	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
5	Q9BY67	3.07e-82	260	442	0.399	0.351	CADM1_HUMAN Cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CADM1 PE=1 SV=2
6	Q8R5M8	1.78e-80	256	456	0.392	0.333	CADM1_MOUSE Cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Cadm1 PE=1 SV=2
7	Q6PFK4	6.85e-80	253	405	0.356	0.341	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
8	Q6AYP5	2.02e-77	248	476	0.317	0.258	CADM1_RAT Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1
9	Q8BLQ9	4.05e-77	246	435	0.374	0.333	CADM2_MOUSE Cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Cadm2 PE=1 SV=2
10	Q1WIM2	8.79e-76	243	435	0.371	0.331	CADM2_RAT Cell adhesion molecule 2 OS=Rattus norvegicus OX=10116 GN=Cadm2 PE=1 SV=2
11	Q8N3J6	9.57e-76	243	435	0.371	0.331	CADM2_HUMAN Cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=CADM2 PE=2 SV=1
12	B0CLV6	4.15e-68	223	420	0.351	0.324	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
13	Q8N126	6.92e-64	211	398	0.340	0.332	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
14	Q99N28	6.33e-61	203	396	0.343	0.336	CADM3_MOUSE Cell adhesion molecule 3 OS=Mus musculus OX=10090 GN=Cadm3 PE=1 SV=1
15	Q6UWL6	3.76e-22	100	708	0.240	0.131	KIRR2_HUMAN Kin of IRRE-like protein 2 OS=Homo sapiens OX=9606 GN=KIRREL2 PE=1 SV=3
16	Q7TSU7	6.78e-22	99.8	700	0.237	0.131	KIRR2_MOUSE Kin of IRRE-like protein 2 OS=Mus musculus OX=10090 GN=Kirrel2 PE=1 SV=1
17	Q96J84	1.11e-21	99.4	757	0.255	0.131	KIRR1_HUMAN Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2
18	Q6X936	7.41e-21	97.1	789	0.250	0.123	KIRR1_RAT Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2
19	Q80W68	1.59e-20	95.9	789	0.253	0.124	KIRR1_MOUSE Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1
20	A0A0R4IT86	3.61e-19	91.7	755	0.183	0.094	A0A0R4IT86_DANRE Kin of IRRE-like protein 2 precursor OS=Danio rerio OX=7955 GN=cb33 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	5e-11	53.8	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	2.1e-18	77.5	Immunoglobulin I-set domain
3	PF00047 ig	3.7e-16	70.4	Immunoglobulin domain
4	PF13895 Ig_2	4.9e-21	86.2	Immunoglobulin domain
5	PF13927 Ig_3	7.8e-27	105.0	Immunoglobulin domain
6	PF16680 Ig_4	0.0032	29.3	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	0.023	26.4	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF16706 Izumo-Ig	3.6	18.9	Izumo-like Immunoglobulin domain
9	PF15807 MAP17	6.1e+02	11.9	Membrane-associated protein 117 kDa, PDZK1-interacting protein 1
10	PF07686 V-set	1.2e-13	62.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000014668

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000015593	0.928	Cell adhesion molecule 3
2	60711.ENSCSAP00000002222	0.763	Cell adhesion molecule 2
3	60711.ENSCSAP00000012682	0.567	Erythrocyte membrane protein band 4.1-like 2
4	60711.ENSCSAP00000010699	0.543	Neurofascin
5	60711.ENSCSAP00000014724	0.530	Contactin associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.998	signaling receptor binding
GO:0005126	0.990	cytokine receptor binding
GO:0070851	0.851	growth factor receptor binding
GO:0005172	0.782	vascular endothelial growth factor receptor binding
GO:0042802	0.690	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0001932	0.990	regulation of protein phosphorylation
GO:0031400	0.989	negative regulation of protein modification process
GO:1902531	0.988	regulation of intracellular signal transduction
GO:0080134	0.987	regulation of response to stress
GO:1903034	0.981	regulation of response to wounding
GO:0035020	0.980	regulation of Rac protein signal transduction
GO:0010799	0.980	regulation of peptidyl-threonine phosphorylation
GO:0050730	0.978	regulation of peptidyl-tyrosine phosphorylation
GO:0061041	0.961	regulation of wound healing
GO:0010563	0.958	negative regulation of phosphorus metabolic process
GO:0001933	0.949	negative regulation of protein phosphorylation
GO:0050732	0.927	negative regulation of peptidyl-tyrosine phosphorylation
GO:0042127	0.684	regulation of cell population proliferation
GO:0009987	0.640	cellular process
GO:0048585	0.517	negative regulation of response to stimulus
GO:0040012	0.515	regulation of locomotion
GO:2000145	0.486	regulation of cell motility
GO:0048856	0.427	anatomical structure development
GO:0032501	0.426	multicellular organismal process
GO:0007275	0.412	multicellular organism development
GO:0048518	0.383	positive regulation of biological process
GO:0048731	0.369	system development
GO:0048522	0.342	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.979	plasma membrane
GO:0070161	0.866	anchoring junction
GO:0005622	0.719	intracellular anatomical structure
GO:0043226	0.656	organelle
GO:0005911	0.540	cell-cell junction
GO:0043227	0.492	membrane-bounded organelle
GO:0031252	0.434	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]