StarFunc result for job id Q8NG08

User Input

>input (1087 residues)
MARSSPYLRQLQGPLLPPRDLVEEDDDYLNDDVEEDEESVFIDAEELCSGGVKAGSLPGC
LRVSICDENTQETCKVFGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSP
PNQKHICALFLKECEVSSDDVNKFLTWVKEVSNYKNLNFENLRETLRTFHKETGRKDQKQ
PTQNGQEELFLDNEMSLPLENTIPFRNVMTALQFPKIMEFLPVLLPRHFKWIIGSGSKEM
LKEIEEILGTHPWKLGFSKITYREWKLLRCEASWIAFCQCESLLQLMTDLEKNALIMYSR
LKQICREDGHTYVEVNDLTLTLSNHMSFHAASESLKFLKDIGVVTYEKSCVFPYDLYHAE
RAIAFSICDLMKKPPWHLCVDVEKVLASIHTTKPENSSDDALNESKPDEVRLENPVDVVD
TQDNGDHIWTNGENEINAEISEVQLDQDQVEVPLDRDQVAALEMICSNPVTVISGKGGCG
KTTIVSRLFKHIEQLEEREVKKACEDFEQDQNASEEWITFTEQSQLEADKAIEVLLTAPT
GKAAGLLRQKTGLHAYTLCQVNYSFYSWTQTMMTTNKPWKFSSVRVLVVDEGSLVSVGIF
KSVLNLLCEHSKLSKLIILGDIRQLPSIEPGNLLKDLFETLKSRNCAIELKTNHRAESQL
IVDNATRISRRQFPKFDAELNISDNPTLPISIQDKTFIFVRLPEEDASSQSSKTNHHSCL
YSAVKTLLQENNLQNAKTSQFIAFRRQDCDLINDCCCKHYTGHLTKDHQSRLVFGIGDKI
CCTRNAYLSDLLPENISGSQQNNDLDASSEDFSGTLPDFAKNKRDFESNVRLCNGEIFFI
TNDVTDVTFGKRRSLTINNMAGLEVTVDFKKLMKYCRIKHAWARTIHTFQGSEEQTVVYV
VGKAGRQHWQHVYTAVTRGRCRVYVIAEESQLRNAIMKNSFPRKTRLKHFLQSKLSSSGA
PPADFPSPRKSSGDSGGPSTPSASPLPVVTDHAMTNDVTWSEASSPDERTLTFAERWQLS
SPDGVDTDDDLPKSRASKRTCGVNDDESPSKIFMVGESPQVSSRLQNLRLNNLIPRQLFK
PTDNQET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AAN8	0.787	0.787	0.000	1087	0.647	0.647	D4AAN8.pdb.gz	D4AAN8_RAT DNA helicase B OS=Rattus norvegicus OX=10116 GN=Helb PE=1 SV=3
2	AFDB:Q6NVF4	0.788	0.797	0.000	1074	0.648	0.655	Q6NVF4.pdb.gz	HELB_MOUSE DNA helicase B OS=Mus musculus OX=10090 GN=Helb PE=1 SV=2
3	AFDB:Q8NG08	1.000	1.000	0.000	1087	1.000	1.000	Q8NG08.pdb.gz	HELB_HUMAN DNA helicase B OS=Homo sapiens OX=9606 GN=HELB PE=1 SV=2
4	PDB:5ld2D	0.347	0.577	1.828E-21	605	0.113	0.203	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
5	PDB:3upuA	0.253	0.575	4.089E-16	439	0.076	0.189	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
6	PDB:3k70D	0.291	0.523	1.462E-15	547	0.099	0.197	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
7	PDB:5eanA	0.272	0.280	1.446E-9	1051	0.115	0.119	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
8	AFDB:Q03099	0.176	0.144	9.217E-7	1374	0.119	0.094	Q03099.pdb.gz	YMN3_YEAST Y' element ATP-dependent helicase YML133C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YML133C PE=2 SV=1
9	PDB:7zelA	0.198	0.253	1.227E-6	827	0.045	0.059	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
10	PDB:2is4B	0.200	0.322	3.869E-5	632	0.063	0.109	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
11	PDB:4pj3A	0.167	0.139	4.537E-5	1335	0.049	0.040	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
12	AFDB:Q580H2	0.177	0.310	7.972E-5	569	0.063	0.120	Q580H2.pdb.gz	Q580H2_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.160 PE=3 SV=1
13	PDB:1uaaA	0.178	0.283	1.711E-4	636	0.075	0.127	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
14	PDB:2is6A	0.206	0.323	2.231E-4	654	0.076	0.127	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
15	AFDB:Q86XP3	0.187	0.212	2.564E-4	938	0.055	0.064	Q86XP3.pdb.gz	DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42 PE=1 SV=1
16	AFDB:Q80Y44	0.188	0.225	3.006E-4	875	0.074	0.091	Q80Y44.pdb.gz	DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus OX=10090 GN=Ddx10 PE=1 SV=2
17	PDB:5dcaA	0.204	0.126	3.068E-4	1948	0.098	0.054	5dcaA.pdb.gz
18	AFDB:P90897	0.176	0.196	5.879E-3	959	0.086	0.097	P90897.pdb.gz	RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans OX=6239 GN=rde-12 PE=1 SV=4
19	AFDB:Q8GUG7	0.200	0.266	2.742E-2	781	0.052	0.073	Q8GUG7.pdb.gz	RH50_ARATH DEAD-box ATP-dependent RNA helicase 50 OS=Arabidopsis thaliana OX=3702 GN=RH50 PE=2 SV=2
20	AFDB:E9PU01	0.173	0.107	4.193E-2	1921	0.086	0.048	E9PU01.pdb.gz	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AAN8	0.0	1366	1087	0.649	0.649	D4AAN8_RAT DNA helicase B OS=Rattus norvegicus OX=10116 GN=Helb PE=1 SV=3
2	Q6NVF4	0.0	1361	1074	0.656	0.664	HELB_MOUSE DNA helicase B OS=Mus musculus OX=10090 GN=Helb PE=1 SV=2
3	Q8NG08	0.0	2264	1087	1.000	1.000	HELB_HUMAN DNA helicase B OS=Homo sapiens OX=9606 GN=HELB PE=1 SV=2
4	P9WHJ1	5.23e-07	56.2	575	0.044	0.083	RECD_MYCTU RecBCD enzyme subunit RecD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=recD PE=1 SV=1
5	Q9RT63	0.012	42.0	715	0.040	0.060	RECDL_DEIRA ATP-dependent RecD-like DNA helicase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=recD2 PE=1 SV=1
6	A8VZX9	0.023	41.6	1769	0.030	0.019	A8VZX9_AGRRH Rcorf28 OS=Agrobacterium rhizogenes OX=359 PE=1 SV=1
7	P04993	0.030	40.8	608	0.031	0.056	RECD_ECOLI RecBCD enzyme subunit RecD OS=Escherichia coli (strain K12) OX=83333 GN=recD PE=1 SV=2
8	O70133	0.17	38.5	1380	0.024	0.019	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2
9	Q5BJS0	0.26	37.7	1194	0.017	0.015	DHX30_RAT ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus OX=10116 GN=Dhx30 PE=1 SV=1
10	Q99PU8	0.26	37.7	1217	0.017	0.015	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
11	H7BXY3	0.28	37.7	1166	0.017	0.015	H7BXY3_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
12	Q7L2E3	0.28	37.7	1194	0.017	0.015	DHX30_HUMAN ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
13	Q28141	0.47	37.0	1287	0.016	0.013	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
14	Q08211	0.62	36.6	1270	0.023	0.020	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
15	D4A2Z8	0.96	36.2	1000	0.017	0.019	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
16	Q38B75	0.97	35.8	880	0.015	0.018	Q38B75_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1790 PE=4 SV=1
17	Q9FKZ0	1.1	35.8	815	0.017	0.022	DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana OX=3702 GN=At5g66910 PE=2 SV=1
18	F4HYJ6	1.4	35.4	1206	0.014	0.012	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
19	A2BIE5	1.7	35.0	1150	0.015	0.014	A2BIE5_DANRE DEAH (Asp-Glu-Ala-His) box polypeptide 34 OS=Danio rerio OX=7955 GN=si:ch211-255l12.1 PE=1 SV=2
20	Q9W252	2.0	35.0	1318	0.012	0.010	RAD50_DROME DNA repair protein RAD50 OS=Drosophila melanogaster OX=7227 GN=rad50 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	0.045	25.1	AAA domain
2	PF13173 AAA_14	44	15.5	AAA domain
3	PF13175 AAA_15	1.6	19.8	AAA ATPase domain
4	PF13191 AAA_16	0.55	22.1	AAA ATPase domain
5	PF13245 AAA_19	3.1e-10	51.9	AAA domain
6	PF13401 AAA_22	35	16.1	AAA domain
7	PF13476 AAA_23	2.4e+02	13.6	AAA domain
8	PF13604 AAA_30	2e-21	88.2	AAA domain
9	PF00005 ABC_tran	1.1e+02	14.8	ABC transporter
10	PF01637 ATPase_2	3.8e+02	12.4	ATPase domain predominantly from Archaea
11	PF01656 CbiA	34	15.9	CobQ/CobB/MinD/ParA nucleotide binding domain
12	PF19263 DUF5906	14	17.9	Family of unknown function (DUF5906)
13	PF03205 MobB	2.9e+02	12.8	Molybdopterin guanine dinucleotide synthesis protein B
14	PF00931 NB-ARC	16	16.2	NB-ARC domain
15	PF10609 ParA	2.6e+02	12.4	NUBPL iron-transfer P-loop NTPase
16	PF02562 PhoH	78	14.2	PhoH-like protein
17	PF05970 PIF1	1e+02	13.4	PIF1-like helicase
18	PF03193 RsgA_GTPase	25	16.2	RsgA GTPase
19	PF13538 UvrD_C_2	0.00048	31.3	UvrD-like helicase C-terminal domain
20	PF01443 Viral_helicase1	1.2e-06	40.0	Viral (Superfamily 1) RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247815

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298139	0.837	Werner syndrome ATP-dependent helicase
2	9606.ENSP00000254719	0.812	Replication protein A 70 kDa DNA-binding subunit
3	9606.ENSP00000405726	0.798	Cell division control protein 45 homolog
4	9606.ENSP00000266604	0.758	Protein LLP homolog
5	9606.ENSP00000361180	0.695	General transcription factor 3C polypeptide 5
6	9606.ENSP00000484525	0.687	RNA polymerase II subunit A C-terminal domain phosphatase
7	9606.ENSP00000368458	0.675	Proliferating cell nuclear antigen
8	9606.ENSP00000362285	0.662	Equilibrative nucleoside transporter 3
9	9606.ENSP00000339479	0.639	Cytosolic purine 5'-nucleotidase
10	9606.ENSP00000352257	0.634	X-ray repair cross-complementing protein 6
11	9606.ENSP00000369335	0.632	F-box DNA helicase 1
12	9606.ENSP00000351284	0.625	DNA repair protein RAD52 homolog
13	9606.ENSP00000267430	0.616	Fanconi anemia group M protein
14	9606.ENSP00000265465	0.604	DNA polymerase alpha subunit B
15	9606.ENSP00000349823	0.592	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
16	9606.ENSP00000351185	0.590	DNA replication ATP-dependent helicase/nuclease DNA2
17	9606.ENSP00000442336	0.587	DNA topoisomerase 3-alpha
18	9606.ENSP00000265310	0.581	Transient receptor potential cation channel subfamily V member 5
19	9606.ENSP00000371475	0.562	TP53-binding protein 1
20	9606.ENSP00000482313	0.557	ATP-dependent DNA helicase Q4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0043139	0.998	5'-3' DNA helicase activity
GO:0017116	0.998	single-stranded DNA helicase activity
GO:0044877	0.988	protein-containing complex binding
GO:0005515	0.948	protein binding
GO:1901363	0.708	heterocyclic compound binding
GO:0097159	0.707	organic cyclic compound binding
GO:0003676	0.334	nucleic acid binding
GO:0043167	0.305	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.992	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0050789	0.988	regulation of biological process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0050896	0.987	response to stimulus
GO:0043170	0.986	macromolecule metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0044260	0.982	cellular macromolecule metabolic process
GO:0090304	0.982	nucleic acid metabolic process
GO:0006259	0.971	DNA metabolic process
GO:0006974	0.966	cellular response to DNA damage stimulus
GO:0006260	0.945	DNA replication
GO:0006261	0.940	DNA-templated DNA replication
GO:0080090	0.916	regulation of primary metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:0031323	0.916	regulation of cellular metabolic process
GO:0019219	0.913	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.900	regulation of macromolecule metabolic process
GO:0034654	0.880	nucleobase-containing compound biosynthetic process
GO:0009059	0.863	macromolecule biosynthetic process
GO:0048523	0.836	negative regulation of cellular process
GO:0051052	0.821	regulation of DNA metabolic process
GO:0031324	0.794	negative regulation of cellular metabolic process
GO:0010569	0.786	regulation of double-strand break repair via homologous recombination
GO:0051053	0.776	negative regulation of DNA metabolic process
GO:2001021	0.769	negative regulation of response to DNA damage stimulus
GO:0045910	0.701	negative regulation of DNA recombination
GO:0016070	0.694	RNA metabolic process
GO:0032774	0.633	RNA biosynthetic process
GO:0006281	0.319	DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005694	0.998	chromosome
GO:0016020	0.997	membrane
GO:0000228	0.986	nuclear chromosome
GO:0005657	0.982	replication fork
GO:0140513	0.964	nuclear protein-containing complex
GO:0005886	0.962	plasma membrane
GO:0032993	0.933	protein-DNA complex
GO:0043596	0.924	nuclear replication fork
GO:0030894	0.874	replisome
GO:0043601	0.860	nuclear replisome
GO:0090734	0.852	site of DNA damage
GO:0035861	0.772	site of double-strand break
GO:0005662	0.721	DNA replication factor A complex
GO:0098687	0.373	chromosomal region
GO:0000781	0.322	chromosome, telomeric region
GO:1902494	0.302	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.998	DNA 5'-3' helicase.

[back to server]