StarFunc result for job id Q8NG31

User Input

>input (2342 residues)
MDGVSSEANEENDNIERPVRRRHSSILKPPRSPLQDLRGGNERVQESNALRNKKNSRRVS
FADTIKVFQTESHMKIVRKSEMEGCSAMVPSQLQLLPPGFKRFSCLSLPETETGENLLLI
QNKKLEDNYCEITGMNTLLSAPIHTQMQQKEFSIIEHTRERKHANDQTVIFSDENQMDLT
SSHTVMITKGLLDNPISEKSTKIDTTSFLANLKLHTEDSRMKKEVNFSVDQNTSSENKID
FNDFIKRLKTGKCSAFPDVPDKENFEIPIYSKEPNSASSTHQMHVSLKEDENNSNITRLF
REKDDGMNFTQCHTANIQTLIPTSSETNSRESKGNDITIYGNDFMDLTFNHTLQILPATG
NFSEIENQTQNAMDVTTGYGTKASGNKTVFKSKQNTAFQDLSINSADKIHITRSHIMGAE
THIVSQTCNQDARILAMTPESIYSNPSIQGCKTVFYSSCNDAMEMTKCLSNMREEKNLLK
HDSNYAKMYCNPDAMSSLTEKTIYSGEENMDITKSHTVAIDNQIFKQDQSNVQIAAAPTP
EKEMMLQNLMTTSEDGKMNVNCNSVPHVSKERIQQSLSNPLSISLTDRKTELLSGENMDL
TESHTSNLGSQVPLAAYNLAPESTSESHSQSKSSSDECEEITKSRNEPFQRSDIIAKNSL
TDTWNKDKDWVLKILPYLDKDSPQSADCNQEIATSHNIVYCGGVLDKQITNRNTVSWEQS
LFSTTKPLFSSGQFSMKNHDTAISSHTVKSVLGQNSKLAEPLRKSLSNPTPDYCHDKMII
CSEEEQNMDLTKSHTVVIGFGPSELQELGKTNLEHTTGQLTTMNRQIAVKVEKCGKSPIE
KSGVLKSNCIMDVLEDESVQKPKFPKEKQNVKIWGRKSVGGPKIDKTIVFSEDDKNDMDI
TKSYTIEINHRPLLEKRDCHLVPLAGTSETILYTCRQDDMEITRSHTTALECKTVSPDEI
TTRPMDKTVVFVDNHVELEMTESHTVFIDYQEKERTDRPNFELSQRKSLGTPTVICTPTE
ESVFFPGNGESDRLVANDSQLTPLEEWSNNRGPVEVADNMELSKSATCKNIKDVQSPGFL
NEPLSSKSQRRKSLKLKNDKTIVFSENHKNDMDITQSCMVEIDNESALEDKEDFHLAGAS
KTILYSCGQDDMEITRSHTTALECKTLLPNEIAIRPMDKTVLFTDNYSDLEVTDSHTVFI
DCQATEKILEENPKFGIGKGKNLGVSFPKDNSCVQEIAEKQALAVGNKIVLHTEQKQQLF
AATNRTTNEIIKFHSAAMDEKVIGKVVDQACTLEKAQVESCQLNNRDRRNVDFTSSHATA
VCGSSDNYSCLPNVISCTDNLEGSAMLLCDKDEEKANYCPVQNDLAYANDFASEYYLESE
GQPLSAPCPLLEKEEVIQTSTKGQLDCVITLHKDQDLIKDPRNLLANQTLVYSQDLGEMT
KLNSKRVSFKLPKDQMKVYVDDIYVIPQPHFSTDQPPLPKKGQSSINKEEVILSKAGNKS
LNIIENSSAPICENKPKILNSEEWFAAACKKELKENIQTTNYNTALDFHSNSDVTKQVIQ
THVNAGEAPDPVITSNVPCFHSIKPNLNNLNGKTGEFLAFQTVHLPPLPEQLLELGNKAH
NDMHIVQATEIHNINIISSNAKDSRDEENKKSHNGAETTSLPPKTVFKDKVRRCSLGIFL
PRLPNKRNCSVTGIDDLEQIPADTTDINHLETQPVSSKDSGIGSVAGKLNLSPSQYINEE
NLPVYPDEINSSDSINIETEEKALIETYQKEISPYENKMGKTCNSQKRTWVQEEEDIHKE
KKIRKNEIKFSDTTQDREIFDHHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKADGTS
LDFSTYRSSQMESQFLRDTICEESLREKLQDGRITIREFFILLQVHILIQKPRQSNLPGN
FTVNTPPTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELKLSASNQDKLLVDINKNLWE
KMRHCSDKELKAFGIYLNKIKSCFTKMTKVFTHQGKVALYGKLVQSAQNEREKLQIKIDE
MDKILKKIDNCLTEMETETKNLEDEEKNNPVEEWDSEMRAAEKELEQLKTEEEELQRNLL
ELEVQKEQTLAQIDFMQKQRNRTEELLDQLSLSEWDVVEWSDDQAVFTFVYDTIQLTITF
EESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQH
QLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEI
TLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQDCHF
YH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NG31	1.000	1.000	0.000	2342	1.000	1.000	Q8NG31.pdb.gz	KNL1_HUMAN Kinetochore scaffold 1 OS=Homo sapiens OX=9606 GN=KNL1 PE=1 SV=3
2	AFDB:O59757	0.065	0.105	9.831E-13	1364	0.083	0.142	O59757.pdb.gz	SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spc7 PE=1 SV=1
3	PDB:7apkM	0.061	0.206	2.247E-5	549	0.029	0.126	7apkM.pdb.gz
4	PDB:7apkE	0.063	0.217	5.435E-5	523	0.026	0.119	7apkE.pdb.gz
5	AFDB:M9PIC9	0.058	0.068	9.802E-3	1960	0.130	0.156	M9PIC9.pdb.gz	M9PIC9_DROME Spc105-related, isoform B OS=Drosophila melanogaster OX=7227 GN=Spc105R PE=4 SV=1
6	PDB:6qleP	0.059	0.367	1.358E-2	242	0.011	0.103	6qleP.pdb.gz
7	AFDB:Q99KW3	0.062	0.069	1.525E-2	2014	0.117	0.136	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
8	PDB:7r5vO	0.051	0.344	2.232E-2	210	0.013	0.143	7r5vO.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
9	AFDB:Q9BTC0	0.043	0.045	2.798E-2	2240	0.116	0.121	Q9BTC0.pdb.gz	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
10	AFDB:Q8C9B9	0.030	0.031	2.957E-2	2256	0.117	0.122	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
11	PDB:2bo9B	0.026	0.154	3.285E-2	217	0.007	0.074	2bo9B.pdb.gz	Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
12	PDB:4q5eC	0.025	0.331	4.835E-2	155	0.007	0.103	4q5eC.pdb.gz
13	AFDB:H2KYH3	0.030	0.029	6.406E-2	2476	0.105	0.099	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
14	PDB:6gvwC	0.043	0.173	8.399E-2	383	0.016	0.097	6gvwC.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
15	AFDB:Q9H2D6	0.043	0.043	9.428E-2	2365	0.132	0.130	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
16	PDB:7lbmr	0.044	0.086	9.912E-2	1034	0.010	0.023	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	AFDB:Q5HZI1	0.037	0.064	1.313E-1	1210	0.074	0.143	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
18	PDB:3rb9A	0.027	0.086	1.380E-1	395	0.008	0.046	3rb9A.pdb.gz
19	AFDB:E9Q4F7	0.034	0.031	1.466E-1	2643	0.130	0.115	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
20	PDB:7nvrl	0.041	0.120	1.629E-1	501	0.019	0.090	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NG31	0.0	4857	2342	1.000	1.000	KNL1_HUMAN Kinetochore scaffold 1 OS=Homo sapiens OX=9606 GN=KNL1 PE=1 SV=3
2	F8W8G5	0.094	40.4	726	0.007	0.022	F8W8G5_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
3	A0A087WTI6	0.097	40.4	660	0.007	0.024	A0A087WTI6_HUMAN MYB proto-oncogene, transcription factor OS=Homo sapiens OX=9606 GN=MYB PE=1 SV=1
4	A0A087WWR3	0.14	39.3	333	0.007	0.048	A0A087WWR3_HUMAN Hydroxysteroid 11-beta dehydrogenase 1 like OS=Homo sapiens OX=9606 GN=HSD11B1L PE=1 SV=1
5	H0YM11	1.3	35.8	217	0.010	0.111	H0YM11_HUMAN Kinetochore localized astrin (SPAG5) binding protein (Fragment) OS=Homo sapiens OX=9606 GN=KNSTRN PE=1 SV=1
6	Q9I3L8	2.6	35.4	551	0.013	0.054	Q9I3L8_PSEAE Mucoidy inhibitor MuiA OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1494 PE=4 SV=1
7	O94533	4.1	35.0	760	0.023	0.071	ELP2_SCHPO Elongator complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp2 PE=3 SV=1
8	Q96PP8	5.6	34.7	586	0.013	0.053	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
9	Q5B3B1	8.1	34.3	738	0.016	0.050	NDC80_EMENI Probable kinetochore protein ndc80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ndc80 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18210 Knl1_RWD_C	7.1e-29	112.5	Knl1 RWD C-terminal domain
2	PF19221 MELT	8.8e-74	252.7	MELT motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335463

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287598	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
2	9606.ENSP00000302530	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1
3	9606.ENSP00000363055	0.999	ZW10 interactor
4	9606.ENSP00000261597	0.998	Kinetochore protein NDC80 homolog
5	9606.ENSP00000355944	0.997	Kinetochore-associated protein NSL1 homolog
6	9606.ENSP00000389810	0.997	Kinetochore-associated protein DSN1 homolog
7	9606.ENSP00000484532	0.995	Protein MIS12 homolog
8	9606.ENSP00000465075	0.994	Kinetochore protein Spc24
9	9606.ENSP00000357858	0.992	Mitotic checkpoint protein BUB3
10	9606.ENSP00000271452	0.988	Kinetochore protein Nuf2
11	9606.ENSP00000356379	0.982	Abnormal spindle-like microcephaly-associated protein
12	9606.ENSP00000282074	0.964	Kinetochore protein Spc25
13	9606.ENSP00000361540	0.960	Cell division cycle protein 20 homolog
14	9606.ENSP00000457810	0.958	Centromere protein T
15	9606.ENSP00000265148	0.955	Centromere-associated protein E
16	9606.ENSP00000273853	0.940	Centromere protein C
17	9606.ENSP00000341779	0.930	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
18	9606.ENSP00000313950	0.916	Aurora kinase B
19	9606.ENSP00000379911	0.914	Centromere protein K
20	9606.ENSP00000358813	0.908	Dual specificity protein kinase TTK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051179	0.958	localization
GO:0022402	0.945	cell cycle process
GO:0051641	0.936	cellular localization
GO:0098813	0.914	nuclear chromosome segregation
GO:0034502	0.873	protein localization to chromosome
GO:0071459	0.849	protein localization to chromosome, centromeric region
GO:1903083	0.830	protein localization to condensed chromosome
GO:0034501	0.824	protein localization to kinetochore
GO:0008608	0.769	attachment of spindle microtubules to kinetochore
GO:0065007	0.708	biological regulation
GO:0050789	0.702	regulation of biological process
GO:0050794	0.654	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0000776	0.999	kinetochore
GO:0016604	0.998	nuclear body
GO:0001669	0.998	acrosomal vesicle
GO:0032991	0.915	protein-containing complex
GO:0005856	0.408	cytoskeleton
GO:0015630	0.325	microtubule cytoskeleton
GO:0005813	0.321	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]