StarFunc result for job id Q8NG66

User Input

>input (645 residues)
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVL
KEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKI
QEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSR
LLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSI
VLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSE
MTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKL
KKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYA
DAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSL
DTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNAS
EAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NG66	1.000	1.000	1.899E-100	645	1.000	1.000	Q8NG66.pdb.gz	NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens OX=9606 GN=NEK11 PE=1 SV=2
2	AFDB:Q57V67	0.417	0.530	6.855E-25	503	0.194	0.249	Q57V67.pdb.gz	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1
3	AFDB:O35942	0.394	0.566	4.576E-24	443	0.194	0.282	O35942.pdb.gz	NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus OX=10090 GN=Nek2 PE=1 SV=2
4	AFDB:D3ZBE5	0.389	0.801	1.710E-23	302	0.144	0.308	D3ZBE5.pdb.gz	NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=1 SV=1
5	AFDB:Q7TSC3	0.394	0.405	4.419E-23	627	0.237	0.244	Q7TSC3.pdb.gz	NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1
6	AFDB:P51956	0.384	0.485	4.911E-23	506	0.212	0.271	P51956.pdb.gz	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
7	AFDB:P48479	0.401	0.305	2.519E-22	858	0.217	0.163	P48479.pdb.gz	NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nim-1 PE=2 SV=2
8	AFDB:G5EHL3	0.408	0.444	4.268E-22	591	0.200	0.218	G5EHL3.pdb.gz	G5EHL3_MAGO7 NEK protein kinase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g813 PE=4 SV=1
9	AFDB:A0A024R8A6	0.381	0.758	4.499E-22	313	0.144	0.297	A0A024R8A6.pdb.gz
10	AFDB:G5EFM9	0.386	0.796	5.270E-22	302	0.136	0.291	G5EFM9.pdb.gz	NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans OX=6239 GN=nekl-3 PE=1 SV=1
11	PDB:6s73A	0.367	0.847	5.743E-21	269	0.136	0.327	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
12	PDB:4rgjA	0.348	0.475	4.263E-17	463	0.141	0.197	4rgjA.pdb.gz
13	PDB:3eqdA	0.371	0.735	1.434E-16	315	0.116	0.238	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:4d28C	0.357	0.789	4.340E-16	279	0.109	0.251	4d28C.pdb.gz
15	PDB:4eomC	0.346	0.777	5.955E-16	276	0.113	0.264	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:6b1uA	0.373	0.535	5.955E-16	442	0.122	0.179	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:3uc3A	0.346	0.773	6.278E-16	272	0.141	0.335	3uc3A.pdb.gz	Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases.
18	PDB:4zhxA	0.365	0.563	6.618E-16	409	0.124	0.196	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:4ek6A	0.333	0.748	6.976E-16	279	0.118	0.272	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
20	PDB:7myjC	0.356	0.488	8.172E-16	465	0.122	0.170	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NG66	0.0	1335	645	1.000	1.000	NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens OX=9606 GN=NEK11 PE=1 SV=2
2	Q5M813	9.08e-70	231	309	0.192	0.401	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
3	P51957	2.57e-68	240	841	0.177	0.136	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
4	A0A8I5ZKL8	1.61e-66	234	743	0.175	0.152	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
5	Q9Z1J2	3.42e-66	234	792	0.175	0.143	NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus OX=10090 GN=Nek4 PE=1 SV=1
6	D3ZDV9	3.79e-66	234	793	0.175	0.142	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
7	A0A8I5ZLB3	4.24e-66	233	756	0.175	0.149	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
8	A0A8I6A574	5.04e-66	234	829	0.175	0.136	A0A8I6A574_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
9	Q9R0A5	9.91e-66	226	511	0.200	0.252	NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus OX=10090 GN=Nek3 PE=1 SV=2
10	P51956	1.56e-64	223	506	0.169	0.215	NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2
11	P51954	1.87e-64	233	1203	0.161	0.086	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2
12	Q7TSC3	1.53e-63	223	627	0.167	0.172	NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1
13	Q96PY6	3.12e-63	229	1258	0.161	0.083	NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2
14	Q9LT35	3.67e-60	209	416	0.171	0.264	NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana OX=3702 GN=NEK6 PE=3 SV=1
15	Q38CJ2	6.72e-59	213	764	0.225	0.190	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
16	Q6YY75	1.51e-56	202	534	0.167	0.202	NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK6 PE=1 SV=2
17	Q0WPH8	3.53e-54	201	956	0.163	0.110	NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana OX=3702 GN=NEK5 PE=1 SV=1
18	Q388G0	7.91e-54	201	1506	0.153	0.066	Q388G0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2330 PE=4 SV=1
19	Q6ZEZ5	1.61e-51	189	585	0.158	0.174	NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica OX=39947 GN=NEK3 PE=1 SV=1
20	Q57V67	5.59e-49	181	503	0.141	0.181	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	9.5	17.5	Phosphotransferase enzyme family
2	PF00069 Pkinase	2.4e-58	209.2	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	2.4e-42	156.6	Protein tyrosine and serine/threonine kinase
4	PF18215 Rtt106_N	67	14.5	Histone chaperone Rtt106 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364691	0.611	Rootletin
2	9606.ENSP00000380661	0.577	Centrosome-associated protein CEP250
3	9606.ENSP00000376417	0.515	Required for sperm flagellum axoneme organization and function (By similarity). Involved in axonemal central pair complex assembly and/or stability (By similarity).

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	0.998	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0071704	0.964	organic substance metabolic process
GO:0043170	0.952	macromolecule metabolic process
GO:0006468	0.942	protein phosphorylation
GO:0050896	0.926	response to stimulus
GO:0051716	0.887	cellular response to stimulus
GO:0022402	0.883	cell cycle process
GO:1903047	0.844	mitotic cell cycle process
GO:1901987	0.844	regulation of cell cycle phase transition
GO:0010948	0.831	negative regulation of cell cycle process
GO:0006974	0.826	cellular response to DNA damage stimulus
GO:0042770	0.746	signal transduction in response to DNA damage
GO:0000077	0.737	DNA damage checkpoint signaling
GO:0044774	0.735	mitotic DNA integrity checkpoint signaling
GO:0044773	0.734	mitotic DNA damage checkpoint signaling
GO:0071840	0.391	cellular component organization or biogenesis
GO:0016043	0.362	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005654	0.993	nucleoplasm
GO:0005737	0.962	cytoplasm
GO:0015630	0.917	microtubule cytoskeleton
GO:0005829	0.884	cytosol
GO:0005730	0.680	nucleolus
GO:0032991	0.598	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]