StarFunc result for job id Q8NHE4

User Input

>input (81 residues)
MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2KIB5	0.994	0.994	8.945E-13	81	0.975	0.975	Q2KIB5.pdb.gz	VA0E2_BOVIN V-type proton ATPase subunit e 2 OS=Bos taurus OX=9913 GN=ATP6V0E2 PE=1 SV=1
2	PDB:6vq6e	0.945	0.981	5.776E-12	78	0.951	0.987	6vq6e.pdb.gz	Structure of V-ATPase from the mammalian brain.
3	PDB:6wlwS	0.914	0.960	6.796E-9	77	0.691	0.727	6wlwS.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
4	AFDB:F1Q700	0.926	0.926	6.992E-9	81	0.642	0.642	F1Q700.pdb.gz
5	AFDB:O15342	0.920	0.920	8.450E-9	81	0.679	0.679	O15342.pdb.gz	VA0E1_HUMAN V-type proton ATPase subunit e 1 OS=Homo sapiens OX=9606 GN=ATP6V0E1 PE=1 SV=2
6	AFDB:Q20591	0.932	0.879	1.124E-7	86	0.444	0.419	Q20591.pdb.gz	VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans OX=6239 GN=vha-17 PE=1 SV=2
7	AFDB:Q8SZ31	0.856	0.783	9.941E-6	89	0.395	0.360	Q8SZ31.pdb.gz	Q8SZ31_DROME V-type proton ATPase subunit OS=Drosophila melanogaster OX=7227 GN=VhaM9.7-b PE=2 SV=1
8	AFDB:Q69Z14	0.705	0.832	1.131E-3	67	0.272	0.328	Q69Z14.pdb.gz	VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma9 PE=3 SV=2
9	AFDB:Q9FLN5	0.604	0.674	3.999E-3	70	0.222	0.257	Q9FLN5.pdb.gz	VA0E1_ARATH V-type proton ATPase subunit e1 OS=Arabidopsis thaliana OX=3702 GN=VHA-e1 PE=3 SV=1
10	AFDB:Q9SZ13	0.595	0.665	4.260E-3	70	0.247	0.286	Q9SZ13.pdb.gz	VA0E2_ARATH V-type proton ATPase subunit e2 OS=Arabidopsis thaliana OX=3702 GN=VHA-e2 PE=3 SV=1
11	AFDB:Q384K6	0.667	0.780	8.530E-3	68	0.235	0.279	Q384K6.pdb.gz	Q384K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0415 PE=3 SV=1
12	PDB:8eaue	0.642	0.712	4.017E-2	72	0.185	0.208	8eaue.pdb.gz
13	AFDB:Q3E7B6	0.733	0.802	4.995E-2	73	0.198	0.219	Q3E7B6.pdb.gz	VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA9 PE=1 SV=1
14	PDB:1w0bA	0.479	0.403	2.144	102	0.136	0.108	1w0bA.pdb.gz
15	PDB:7aqqf	0.376	0.312	2.939	101	0.148	0.119	7aqqf.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
16	PDB:6zh3A	0.189	0.098	3.335	170	0.123	0.059	6zh3A.pdb.gz
17	PDB:6n63A	0.411	0.275	3.552	141	0.160	0.092	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
18	PDB:7vkkA	0.221	0.084	3.552	287	0.099	0.028	7vkkA.pdb.gz
19	PDB:2l3yA	0.336	0.189	4.293	184	0.049	0.022	2l3yA.pdb.gz
20	PDB:6s7oH	0.436	0.351	4.293	108	0.160	0.120	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHE4	3.98e-54	164	81	1.000	1.000	VA0E2_HUMAN V-type proton ATPase subunit e 2 OS=Homo sapiens OX=9606 GN=ATP6V0E2 PE=2 SV=1
2	Q5EB76	6.74e-54	163	81	0.988	0.988	VA0E2_RAT V-type proton ATPase subunit e 2 OS=Rattus norvegicus OX=10116 GN=Atp6v0e2 PE=1 SV=1
3	Q91XE7	6.74e-54	163	81	0.988	0.988	VA0E2_MOUSE V-type proton ATPase subunit e 2 OS=Mus musculus OX=10090 GN=Atp6v0e2 PE=3 SV=1
4	Q2KIB5	1.01e-53	162	81	0.975	0.975	VA0E2_BOVIN V-type proton ATPase subunit e 2 OS=Bos taurus OX=9913 GN=ATP6V0E2 PE=1 SV=1
5	Q794C0	3.31e-39	126	81	0.704	0.704	VA0E1_RAT V-type proton ATPase subunit e 1 OS=Rattus norvegicus OX=10116 GN=Atp6v0e1 PE=3 SV=3
6	Q9CQD8	3.31e-39	126	81	0.704	0.704	VA0E1_MOUSE V-type proton ATPase subunit e 1 OS=Mus musculus OX=10090 GN=Atp6v0e1 PE=3 SV=3
7	O15342	7.30e-39	125	81	0.704	0.704	VA0E1_HUMAN V-type proton ATPase subunit e 1 OS=Homo sapiens OX=9606 GN=ATP6V0E1 PE=1 SV=2
8	Q5XJC7	6.83e-34	112	81	0.642	0.642	Q5XJC7_DANRE V-type proton ATPase subunit OS=Danio rerio OX=7955 GN=zgc:103433 PE=2 SV=1
9	Q20591	2.19e-23	86.7	86	0.444	0.419	VA0E_CAEEL V-type proton ATPase subunit e OS=Caenorhabditis elegans OX=6239 GN=vha-17 PE=1 SV=2
10	Q8SZ31	1.56e-13	61.6	89	0.395	0.360	Q8SZ31_DROME V-type proton ATPase subunit OS=Drosophila melanogaster OX=7227 GN=VhaM9.7-b PE=2 SV=1
11	Q9VP18	2.43e-13	61.2	89	0.395	0.360	Q9VP18_DROME V-type proton ATPase subunit OS=Drosophila melanogaster OX=7227 GN=VhaM9.7-b PE=1 SV=2
12	Q69Z14	4.97e-06	42.0	67	0.247	0.299	VA0E_SCHPO V-type proton ATPase subunit e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vma9 PE=3 SV=2
13	Q9SZ13	1.54e-04	38.1	70	0.247	0.286	VA0E2_ARATH V-type proton ATPase subunit e2 OS=Arabidopsis thaliana OX=3702 GN=VHA-e2 PE=3 SV=1
14	Q9FLN5	3.06e-04	37.4	70	0.272	0.314	VA0E1_ARATH V-type proton ATPase subunit e1 OS=Arabidopsis thaliana OX=3702 GN=VHA-e1 PE=3 SV=1
15	Q384K6	0.053	31.6	68	0.247	0.294	Q384K6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0415 PE=3 SV=1
16	D5AUZ7	1.1	29.3	244	0.136	0.045	CBIQ_RHOCB Cobalt transport protein CbiQ OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) OX=272942 GN=cbiQ PE=1 SV=1
17	Q3E7B6	1.3	28.1	73	0.160	0.178	VA0E_YEAST V-type proton ATPase subunit e OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA9 PE=1 SV=1
18	D7SFK1	3.2	28.1	710	0.370	0.042	D7SFK1_CAEEL ABC transporter family G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=abcx-1 PE=4 SV=2
19	Q9ASS7	6.2	27.3	635	0.173	0.022	CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana OX=3702 GN=CAT2 PE=1 SV=1
20	Q9GL77	7.5	26.9	1079	0.173	0.013	S4A4_BOVIN Electrogenic sodium bicarbonate cotransporter 1 OS=Bos taurus OX=9913 GN=SLC4A4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05493 ATP_synt_H	5.7e-21	86.1	ATP synthase subunit H
2	PF13686 DrsE_2	4.7e+02	12.1	DsrE/DsrF/DrsH-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10029.XP_007618223.1

Rank	PPI partner	STRING score	Description
1	10029.XP_007617381.1	0.971	Belongs to the V-ATPase proteolipid subunit family.
2	10029.XP_007612577.1	0.967	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
3	10029.XP_007607317.1	0.956	V-type proton ATPase subunit E 1
4	10029.XP_007626278.1	0.954	V-type proton ATPase subunit S1
5	10029.XP_007612850.1	0.951	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
6	10029.XP_007635446.1	0.949	V-type proton ATPase catalytic subunit A
7	10029.XP_007610032.1	0.948	Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.
8	10029.XP_007606616.1	0.946	Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
9	10029.XP_007631794.1	0.945	Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
10	10029.XP_007618457.1	0.940	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase.
11	10029.XP_007634426.1	0.939	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
12	10029.XP_007632664.1	0.938	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system
13	10029.XP_007607326.1	0.936	Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase
14	10029.XP_007634972.1	0.935	V-type proton ATPase subunit D
15	10029.XP_007619691.1	0.927	V-type proton ATPase subunit d 2 isoform X2
16	10029.XP_007634726.1	0.925	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase.
17	10029.XP_007607764.1	0.902	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
18	10029.XP_007623143.1	0.901	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase.
19	10029.XP_007615998.1	0.897	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase.
20	10029.XP_007612080.1	0.895	V-type proton ATPase subunit B, kidney isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046961	1.000	proton-transporting ATPase activity, rotational mechanism
GO:0005488	0.986	binding
GO:0005515	0.962	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098660	0.996	inorganic ion transmembrane transport
GO:1902600	0.990	proton transmembrane transport
GO:0065007	0.330	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0098588	0.998	bounding membrane of organelle
GO:0012505	0.992	endomembrane system
GO:0005773	0.992	vacuole
GO:0033176	0.987	proton-transporting V-type ATPase complex
GO:0005774	0.980	vacuolar membrane
GO:0031410	0.976	cytoplasmic vesicle
GO:0030659	0.835	cytoplasmic vesicle membrane
GO:0005764	0.820	lysosome
GO:0030139	0.789	endocytic vesicle
GO:0005765	0.758	lysosomal membrane
GO:0045335	0.755	phagocytic vesicle
GO:0030666	0.754	endocytic vesicle membrane
GO:0030670	0.744	phagocytic vesicle membrane
GO:0005768	0.727	endosome
GO:0010008	0.693	endosome membrane
GO:0033177	0.494	proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0016471	0.310	vacuolar proton-transporting V-type ATPase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57721	1.000	ATP + 4 H(+)(in) + H2O => ADP + 5 H(+)(out) + phosphate

[back to server]