StarFunc result for job id Q8NHG7

User Input

>input (77 residues)
MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQ
IATSGPPPEGGLRWTVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHG7	1.000	1.000	1.521E-11	77	1.000	1.000	Q8NHG7.pdb.gz	SVIP_HUMAN Small VCP/p97-interacting protein OS=Homo sapiens OX=9606 GN=SVIP PE=1 SV=1
2	AFDB:F1QE34	0.292	0.058	5.544	421	0.169	0.031	F1QE34.pdb.gz
3	AFDB:Q02336	0.243	0.070	6.008	434	0.143	0.025	Q02336.pdb.gz	ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADA2 PE=1 SV=1
4	AFDB:Q9H5C5	0.217	0.101	7.057	234	0.169	0.056	Q9H5C5.pdb.gz	Q9H5C5_HUMAN HCG1643967 OS=Homo sapiens OX=9606 GN=FLJ23584 PE=1 SV=1
5	AFDB:K7DY28	0.322	0.158	9.735	171	0.156	0.070	K7DY28.pdb.gz
6	AFDB:Q6NW89	0.308	0.144	9.735	171	0.169	0.076	Q6NW89.pdb.gz	Q6NW89_DANRE Transcription factor mafG2 OS=Danio rerio OX=7955 GN=mafg2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHG7	6.13e-50	153	77	1.000	1.000	SVIP_HUMAN Small VCP/p97-interacting protein OS=Homo sapiens OX=9606 GN=SVIP PE=1 SV=1
2	P0C0A9	2.48e-31	106	76	0.818	0.829	SVIP_RAT Small VCP/p97-interacting protein OS=Rattus norvegicus OX=10116 GN=Svip PE=1 SV=1
3	Q8IQC6	9.73e-08	46.6	82	0.364	0.341	Q8IQC6_DROME Small VCP interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Svip PE=4 SV=1
4	Q55FG3	0.23	31.2	3848	0.195	0.004	VP13C_DICDI Intermembrane lipid transfer protein tipC OS=Dictyostelium discoideum OX=44689 GN=tipC PE=3 SV=1
5	H3BU77	0.58	28.9	68	0.143	0.162	CC179_HUMAN Coiled-coil domain-containing protein 179 OS=Homo sapiens OX=9606 GN=CCDC179 PE=1 SV=1
6	P53861	0.62	30.0	379	0.169	0.034	ELOA1_YEAST Elongin-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELA1 PE=1 SV=1
7	P0C6F1	0.91	29.6	4456	0.247	0.004	DYH2_MOUSE Dynein axonemal heavy chain 2 OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1
8	A0A0G2JTR4	1.4	28.9	859	0.299	0.027	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
9	Q6ZSM3	1.5	28.9	516	0.169	0.025	MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3
10	Q5SSL4	1.6	28.9	859	0.299	0.027	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
11	Q12979	1.9	28.5	859	0.299	0.027	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
12	Q9P225	2.0	28.5	4427	0.247	0.004	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
13	Q5CZC0	2.7	28.1	6907	0.182	0.002	FSIP2_HUMAN Fibrous sheath-interacting protein 2 OS=Homo sapiens OX=9606 GN=FSIP2 PE=2 SV=4
14	Q68SP3	2.9	28.1	785	0.273	0.027	Q68SP3_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=stat5.1 PE=1 SV=1
15	A2AGL3	4.1	27.7	4863	0.182	0.003	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
16	Q9DG74	4.3	27.7	784	0.260	0.026	Q9DG74_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=STAT5 PE=2 SV=1
17	Q9QWM1	5.2	27.3	560	0.195	0.027	NR5A2_RAT Nuclear receptor subfamily 5 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr5a2 PE=2 SV=1
18	P52632	5.6	27.3	786	0.260	0.025	STA5B_RAT Signal transducer and activator of transcription 5B OS=Rattus norvegicus OX=10116 GN=Stat5b PE=1 SV=1
19	P42232	5.9	27.3	786	0.260	0.025	STA5B_MOUSE Signal transducer and activator of transcription 5B OS=Mus musculus OX=10090 GN=Stat5b PE=1 SV=1
20	P42230	6.4	26.9	793	0.260	0.025	STA5A_MOUSE Signal transducer and activator of transcription 5A OS=Mus musculus OX=10090 GN=Stat5a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15811 SVIP	1.6e-21	87.8	Small VCP/p97-interacting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021668

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005742	0.967	Valosin containing protein
2	61853.ENSNLEP00000003881	0.876	UBX domain protein 6
3	61853.ENSNLEP00000000886	0.855	UBX domain protein 2A
4	61853.ENSNLEP00000016770	0.854	NPL4 homolog, ubiquitin recognition factor
5	61853.ENSNLEP00000010626	0.847	UBX domain protein 4
6	61853.ENSNLEP00000004896	0.844	UBX domain protein 1
7	61853.ENSNLEP00000011379	0.810	NSFL1 (p97) cofactor (p47)
8	61853.ENSNLEP00000014537	0.807	UBX domain protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043621	1.000	protein self-association
GO:0051117	1.000	ATPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.988	negative regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0080134	0.985	regulation of response to stress
GO:0048585	0.985	negative regulation of response to stimulus
GO:0010605	0.982	negative regulation of macromolecule metabolic process
GO:1903573	0.981	negative regulation of response to endoplasmic reticulum stress
GO:0032434	0.979	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0031324	0.977	negative regulation of cellular metabolic process
GO:0051128	0.967	regulation of cellular component organization
GO:0044087	0.967	regulation of cellular component biogenesis
GO:0031330	0.967	negative regulation of cellular catabolic process
GO:1901799	0.967	negative regulation of proteasomal protein catabolic process
GO:0051129	0.958	negative regulation of cellular component organization
GO:0032435	0.929	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043254	0.917	regulation of protein-containing complex assembly
GO:0031333	0.829	negative regulation of protein-containing complex assembly
GO:0048518	0.801	positive regulation of biological process
GO:0032879	0.745	regulation of localization
GO:0060341	0.685	regulation of cellular localization
GO:0032880	0.635	regulation of protein localization
GO:0048522	0.603	positive regulation of cellular process
GO:0009987	0.516	cellular process
GO:0009893	0.452	positive regulation of metabolic process
GO:0031326	0.451	regulation of cellular biosynthetic process
GO:1903828	0.394	negative regulation of protein localization
GO:0051173	0.369	positive regulation of nitrogen compound metabolic process
GO:0051049	0.365	regulation of transport
GO:0032387	0.321	negative regulation of intracellular transport
GO:0010556	0.319	regulation of macromolecule biosynthetic process
GO:0051224	0.319	negative regulation of protein transport
GO:0033157	0.313	regulation of intracellular protein transport
GO:0009896	0.306	positive regulation of catabolic process
GO:0031399	0.305	regulation of protein modification process
GO:0051247	0.303	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.999	bounding membrane of organelle
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0071944	0.996	cell periphery
GO:0070062	0.995	extracellular exosome
GO:0005886	0.994	plasma membrane
GO:0031410	0.990	cytoplasmic vesicle
GO:0030659	0.976	cytoplasmic vesicle membrane
GO:0030141	0.975	secretory granule
GO:0070820	0.968	tertiary granule
GO:0030667	0.967	secretory granule membrane
GO:0070821	0.955	tertiary granule membrane
GO:0032991	0.891	protein-containing complex
GO:0005829	0.882	cytosol
GO:0005634	0.351	nucleus
GO:0070013	0.331	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]