StarFunc result for job id Q8NHJ6

User Input

>input (448 residues)
MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRL
DKEESPAPWDRQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGA
YSKPTLSALPSPLVTSGKSVTLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEF
PMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEDPRPSPTRSVSTAAGPED
QPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTY
AKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTL
RQKATEPPPSQEGASPAEPSVYATLAIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHJ6	1.000	1.000	1.419E-76	448	1.000	1.000	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
2	AFDB:O75022	0.285	0.206	1.087E-47	631	0.728	0.517	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	AFDB:O75023	0.234	0.180	2.649E-37	590	0.583	0.442	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
4	AFDB:Q8N423	0.226	0.172	1.864E-36	598	0.580	0.435	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
5	AFDB:P97484	0.237	0.127	9.596E-34	841	0.460	0.245	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
6	AFDB:A6NI73	0.446	0.656	6.387E-33	299	0.362	0.542	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
7	AFDB:Q64281	0.445	0.591	1.247E-32	335	0.299	0.400	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
8	AFDB:Q61450	0.452	0.662	1.037E-31	303	0.277	0.409	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
9	AFDB:P59901	0.252	0.228	1.628E-28	499	0.371	0.333	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
10	AFDB:Q8C567	0.424	0.577	1.925E-28	325	0.263	0.363	Q8C567.pdb.gz	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
11	PDB:5c6wJ	0.201	0.337	6.665E-9	238	0.071	0.134	5c6wJ.pdb.gz
12	PDB:6dlfA	0.163	0.283	5.156E-7	236	0.058	0.110	6dlfA.pdb.gz
13	PDB:1cf8L	0.184	0.335	8.054E-7	215	0.074	0.153	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
14	PDB:1ct8A	0.175	0.326	1.007E-6	214	0.062	0.131	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
15	PDB:1n0xL	0.168	0.303	1.406E-6	215	0.049	0.102	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
16	PDB:6dldD	0.176	0.271	1.859E-6	269	0.067	0.112	6dldD.pdb.gz
17	PDB:1aifA	0.184	0.336	1.965E-6	215	0.078	0.163	1aifA.pdb.gz
18	PDB:1seqL	0.185	0.357	2.323E-6	208	0.067	0.144	1seqL.pdb.gz
19	PDB:1uwxL	0.173	0.317	2.323E-6	211	0.069	0.147	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
20	PDB:1f11A	0.181	0.338	2.456E-6	216	0.069	0.144	1f11A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHJ6	0.0	914	448	1.000	1.000	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
2	Q8NHL6	1.06e-145	432	650	0.583	0.402	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
3	O75022	1.09e-139	416	631	0.571	0.406	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
4	A6NI73	2.69e-90	278	299	0.348	0.522	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
5	Q8N423	2.50e-89	285	597	0.449	0.337	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	O75023	6.02e-85	273	590	0.431	0.327	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
7	P97484	6.80e-75	252	841	0.400	0.213	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
8	P59901	4.09e-71	234	499	0.288	0.259	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
9	Q64281	2.36e-70	228	335	0.346	0.463	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
10	Q28109	3.21e-68	220	264	0.261	0.443	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
11	O75019	1.29e-67	225	489	0.281	0.258	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
12	Q61450	7.85e-65	212	303	0.301	0.446	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
13	Q8C567	4.11e-64	211	325	0.266	0.366	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
14	Q8N149	1.13e-62	212	483	0.279	0.259	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
15	Q8N6C8	1.49e-62	211	439	0.272	0.278	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
16	O76036	2.19e-52	180	304	0.266	0.391	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
17	Q9HCN6	1.28e-48	171	339	0.232	0.307	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
18	P0C191	1.49e-45	162	313	0.252	0.361	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
19	P43631	1.44e-41	151	304	0.243	0.359	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
20	Q14943	1.98e-41	153	382	0.243	0.285	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16066 DUF4808	83	15.2	Domain of unknown function (DUF4808)
2	PF00047 ig	3.2e-07	41.8	Immunoglobulin domain
3	PF13895 Ig_2	8.4e-13	59.8	Immunoglobulin domain
4	PF13927 Ig_3	5.3e-06	38.2	Immunoglobulin domain
5	PF15176 LRR19-TM	4.1e+02	12.5	Leucine-rich repeat family 19 TM domain
6	PF15330 SIT	1.5e+02	14.3	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358165	0.914	High affinity immunoglobulin gamma Fc receptor I
2	9606.ENSP00000391592	0.910	Tyrosine-protein phosphatase non-receptor type 6
3	9606.ENSP00000356946	0.900	Low affinity immunoglobulin gamma Fc region receptor III-A
4	9606.ENSP00000351497	0.892	Low affinity immunoglobulin gamma Fc region receptor II-b
5	9606.ENSP00000433642	0.886	Low affinity immunoglobulin gamma Fc region receptor III-B
6	9606.ENSP00000271450	0.875	Low affinity immunoglobulin gamma Fc region receptor II-a
7	9606.ENSP00000412927	0.824	HLA class I histocompatibility antigen, alpha chain G
8	9606.ENSP00000329507	0.774	CMRF35-like molecule 6
9	9606.ENSP00000365817	0.722	HLA class I histocompatibility antigen, alpha chain E
10	9606.ENSP00000259951	0.709	HLA class I histocompatibility antigen, alpha chain F
11	9606.ENSP00000379873	0.707	HLA class I histocompatibility antigen, A-3 alpha chain
12	9606.ENSP00000365402	0.681	HLA class I histocompatibility antigen, Cw-7 alpha chain
13	9606.ENSP00000399168	0.678	HLA class I histocompatibility antigen, B-7 alpha chain
14	9606.ENSP00000452780	0.669	Beta-2-microglobulin
15	9606.ENSP00000364907	0.662	Tyrosine-protein kinase SYK
16	9606.ENSP00000332049	0.657	T-lymphocyte activation antigen CD86
17	9606.ENSP00000340944	0.634	Tyrosine-protein phosphatase non-receptor type 11
18	9606.ENSP00000264246	0.592	T-lymphocyte activation antigen CD80
19	9606.ENSP00000262629	0.583	TYRO protein tyrosine kinase-binding protein
20	9606.ENSP00000454623	0.579	Integrin alpha-X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0019902	0.983	phosphatase binding
GO:0019903	0.967	protein phosphatase binding
GO:0038023	0.659	signaling receptor activity
GO:0098772	0.578	molecular function regulator activity
GO:0030547	0.505	signaling receptor inhibitor activity
GO:0030234	0.498	enzyme regulator activity
GO:0019887	0.487	protein kinase regulator activity
GO:0004860	0.473	protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0048523	0.993	negative regulation of cellular process
GO:0007154	0.992	cell communication
GO:0023052	0.991	signaling
GO:0050865	0.991	regulation of cell activation
GO:0002683	0.989	negative regulation of immune system process
GO:0051716	0.986	cellular response to stimulus
GO:0048518	0.985	positive regulation of biological process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0051249	0.980	regulation of lymphocyte activation
GO:2000026	0.979	regulation of multicellular organismal development
GO:0060284	0.979	regulation of cell development
GO:0032501	0.978	multicellular organismal process
GO:0007165	0.978	signal transduction
GO:0050776	0.977	regulation of immune response
GO:0002684	0.976	positive regulation of immune system process
GO:0032944	0.969	regulation of mononuclear cell proliferation
GO:0002698	0.969	negative regulation of immune effector process
GO:0002695	0.968	negative regulation of leukocyte activation
GO:0048585	0.967	negative regulation of response to stimulus
GO:0008285	0.967	negative regulation of cell population proliferation
GO:1902105	0.967	regulation of leukocyte differentiation
GO:1903037	0.965	regulation of leukocyte cell-cell adhesion
GO:0010721	0.965	negative regulation of cell development
GO:0032945	0.964	negative regulation of mononuclear cell proliferation
GO:0050863	0.963	regulation of T cell activation
GO:1903038	0.961	negative regulation of leukocyte cell-cell adhesion
GO:0051250	0.961	negative regulation of lymphocyte activation
GO:0010468	0.960	regulation of gene expression
GO:0050670	0.959	regulation of lymphocyte proliferation
GO:0002819	0.958	regulation of adaptive immune response
GO:0051240	0.957	positive regulation of multicellular organismal process
GO:1903707	0.956	negative regulation of hemopoiesis
GO:0002703	0.955	regulation of leukocyte mediated immunity
GO:1902106	0.954	negative regulation of leukocyte differentiation
GO:0050868	0.952	negative regulation of T cell activation
GO:0045670	0.951	regulation of osteoclast differentiation
GO:0001817	0.950	regulation of cytokine production
GO:0002707	0.949	negative regulation of lymphocyte mediated immunity
GO:0002820	0.948	negative regulation of adaptive immune response
GO:0042129	0.947	regulation of T cell proliferation
GO:0050867	0.946	positive regulation of cell activation
GO:0050672	0.943	negative regulation of lymphocyte proliferation
GO:0002376	0.938	immune system process
GO:0002700	0.935	regulation of production of molecular mediator of immune response
GO:0002764	0.935	immune response-regulating signaling pathway
GO:0002762	0.932	negative regulation of myeloid leukocyte differentiation
GO:0006952	0.918	defense response
GO:0051251	0.918	positive regulation of lymphocyte activation
GO:0042130	0.915	negative regulation of T cell proliferation
GO:0007166	0.908	cell surface receptor signaling pathway
GO:1903039	0.908	positive regulation of leukocyte cell-cell adhesion
GO:0001819	0.902	positive regulation of cytokine production
GO:0010629	0.895	negative regulation of gene expression
GO:0002701	0.890	negative regulation of production of molecular mediator of immune response
GO:0050870	0.886	positive regulation of T cell activation
GO:0002822	0.885	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032879	0.884	regulation of localization
GO:0001818	0.884	negative regulation of cytokine production
GO:0051049	0.872	regulation of transport
GO:0002709	0.866	regulation of T cell mediated immunity
GO:1903555	0.841	regulation of tumor necrosis factor superfamily cytokine production
GO:0002718	0.841	regulation of cytokine production involved in immune response
GO:0010646	0.840	regulation of cell communication
GO:0023051	0.839	regulation of signaling
GO:0032680	0.823	regulation of tumor necrosis factor production
GO:0045619	0.823	regulation of lymphocyte differentiation
GO:0031347	0.793	regulation of defense response
GO:0032653	0.778	regulation of interleukin-10 production
GO:0080090	0.776	regulation of primary metabolic process
GO:0051174	0.775	regulation of phosphorus metabolic process
GO:0051171	0.772	regulation of nitrogen compound metabolic process
GO:0051128	0.769	regulation of cellular component organization
GO:0043269	0.756	regulation of monoatomic ion transport
GO:0051246	0.751	regulation of protein metabolic process
GO:0002823	0.747	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0032101	0.746	regulation of response to external stimulus
GO:0032502	0.734	developmental process
GO:0031399	0.731	regulation of protein modification process
GO:0051051	0.721	negative regulation of transport
GO:0065009	0.710	regulation of molecular function
GO:0048584	0.709	positive regulation of response to stimulus
GO:0002768	0.701	immune response-regulating cell surface receptor signaling pathway
GO:0009966	0.698	regulation of signal transduction
GO:0046634	0.687	regulation of alpha-beta T cell activation
GO:0006955	0.667	immune response
GO:0019220	0.650	regulation of phosphate metabolic process
GO:1903556	0.643	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0042325	0.638	regulation of phosphorylation
GO:0032720	0.630	negative regulation of tumor necrosis factor production
GO:0050854	0.600	regulation of antigen receptor-mediated signaling pathway
GO:0001932	0.583	regulation of protein phosphorylation
GO:0031324	0.567	negative regulation of cellular metabolic process
GO:0045620	0.548	negative regulation of lymphocyte differentiation
GO:0042221	0.508	response to chemical
GO:0050778	0.506	positive regulation of immune response
GO:0051252	0.503	regulation of RNA metabolic process
GO:0010033	0.497	response to organic substance
GO:0048856	0.490	anatomical structure development
GO:0051179	0.460	localization
GO:0001775	0.435	cell activation
GO:0050730	0.430	regulation of peptidyl-tyrosine phosphorylation
GO:0071310	0.402	cellular response to organic substance
GO:0050790	0.400	regulation of catalytic activity
GO:0031325	0.397	positive regulation of cellular metabolic process
GO:0043549	0.355	regulation of kinase activity
GO:0048869	0.349	cellular developmental process
GO:0032675	0.344	regulation of interleukin-6 production
GO:1902531	0.338	regulation of intracellular signal transduction
GO:0031326	0.332	regulation of cellular biosynthetic process
GO:0045321	0.327	leukocyte activation
GO:0045088	0.327	regulation of innate immune response
GO:0006810	0.324	transport
GO:0009605	0.319	response to external stimulus
GO:0010556	0.316	regulation of macromolecule biosynthetic process
GO:0045859	0.311	regulation of protein kinase activity
GO:0006355	0.309	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.988	membrane-bounded organelle
GO:0009986	0.985	cell surface
GO:0098552	0.981	side of membrane
GO:0005622	0.977	intracellular anatomical structure
GO:0005576	0.974	extracellular region
GO:0005737	0.945	cytoplasm
GO:0031982	0.918	vesicle
GO:0012505	0.915	endomembrane system
GO:0043231	0.908	intracellular membrane-bounded organelle
GO:0005615	0.907	extracellular space
GO:0043230	0.900	extracellular organelle
GO:1903561	0.886	extracellular vesicle
GO:0070062	0.857	extracellular exosome
GO:0031410	0.648	cytoplasmic vesicle
GO:0012506	0.578	vesicle membrane
GO:0030659	0.328	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]