StarFunc result for job id Q8NHL6

User Input

>input (650 residues)
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRL
YREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTG
AYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRA
IFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEE
TLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGA
HNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKE
GAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVS
GPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLF
LILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQ
PEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD
TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHL6	1.000	1.000	0.000	650	1.000	1.000	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
2	AFDB:Q8N423	0.628	0.681	7.997E-92	598	0.775	0.843	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
3	AFDB:O75019	0.616	0.814	1.055E-78	489	0.568	0.755	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
4	AFDB:Q8N6C8	0.612	0.894	6.505E-76	439	0.566	0.838	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
5	AFDB:O75023	0.603	0.660	1.659E-74	590	0.618	0.681	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
6	AFDB:P59901	0.535	0.677	9.357E-62	499	0.448	0.583	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	AFDB:P97484	0.535	0.421	2.798E-60	841	0.475	0.367	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
8	AFDB:Q9W213	0.146	0.078	6.056E-18	1395	0.148	0.069	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
9	AFDB:F1RE66	0.134	0.084	2.196E-15	1134	0.165	0.094	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
10	AFDB:Q2EY14	0.134	0.085	3.939E-15	1149	0.163	0.092	Q2EY14.pdb.gz	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
11	PDB:5oj2B	0.138	0.130	2.757E-12	692	0.117	0.110	5oj2B.pdb.gz
12	PDB:1e07A	0.142	0.143	2.144E-10	642	0.109	0.111	1e07A.pdb.gz
13	PDB:7q1yA	0.124	0.073	5.287E-10	1374	0.095	0.045	7q1yA.pdb.gz
14	PDB:7vonA	0.135	0.077	1.612E-9	1399	0.085	0.039	7vonA.pdb.gz
15	PDB:7q5zA	0.130	0.071	1.667E-8	1344	0.068	0.033	7q5zA.pdb.gz
16	PDB:4ziqA	0.142	0.075	2.549E-8	1450	0.097	0.043	4ziqA.pdb.gz
17	PDB:5a42A	0.128	0.065	4.111E-8	1597	0.091	0.037	5a42A.pdb.gz
18	PDB:4rtdA	0.133	0.087	5.654E-8	1122	0.080	0.046	4rtdA.pdb.gz
19	PDB:6h03A	0.146	0.091	6.991E-8	1223	0.083	0.044	6h03A.pdb.gz
20	PDB:1hzhH	0.141	0.182	1.069E-7	457	0.078	0.112	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	716	489	0.565	0.751	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	837	631	0.706	0.727	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	O75023	0.0	652	590	0.592	0.653	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
4	Q8N149	0.0	672	483	0.535	0.720	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	Q8N423	0.0	889	597	0.749	0.816	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	Q8N6C8	0.0	726	439	0.566	0.838	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
7	Q8NHL6	0.0	1325	650	1.000	1.000	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	P59901	7.97e-179	519	499	0.425	0.553	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
9	P97484	2.17e-172	514	841	0.480	0.371	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8NHJ6	6.33e-153	451	448	0.405	0.587	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
11	Q8K4V6	2.12e-124	386	697	0.374	0.349	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
12	A6NI73	2.01e-75	245	299	0.205	0.445	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
13	Q8N743	9.37e-71	237	410	0.251	0.398	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	P43630	5.38e-67	228	455	0.278	0.398	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
15	Q14943	3.96e-63	216	382	0.225	0.382	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
16	P43629	1.75e-62	216	444	0.260	0.381	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
17	P43631	5.37e-54	189	304	0.192	0.411	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
18	Q64281	5.03e-53	187	335	0.163	0.316	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
19	Q14954	2.65e-51	181	304	0.188	0.401	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
20	Q61450	3.20e-51	181	303	0.152	0.327	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	5.6e+02	11.7	Adenovirus E3 region protein CR1
2	PF00047 ig	2e-12	58.4	Immunoglobulin domain
3	PF13895 Ig_2	6.4e-24	95.4	Immunoglobulin domain
4	PF13927 Ig_3	1.2e-21	88.4	Immunoglobulin domain
5	PF16680 Ig_4	9.3	18.2	T-cell surface glycoprotein CD3 delta chain
6	PF17870 Insulin_TMD	5.3e+02	12.1	Insulin receptor trans-membrane segment
7	PF04478 Mid2	5e+02	11.8	Mid2 like cell wall stress sensor
8	PF06024 Orf78	6.2e+02	12.1	Orf78 (ac78)
9	PF02009 RIFIN	4.7e+02	12.0	Rifin
10	PF15330 SIT	6.3e+02	12.3	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412927	0.999	HLA class I histocompatibility antigen, alpha chain G
2	9606.ENSP00000452780	0.998	Beta-2-microglobulin
3	9606.ENSP00000259951	0.992	HLA class I histocompatibility antigen, alpha chain F
4	9606.ENSP00000379873	0.992	HLA class I histocompatibility antigen, A-3 alpha chain
5	9606.ENSP00000391592	0.968	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000399168	0.945	HLA class I histocompatibility antigen, B-7 alpha chain
7	9606.ENSP00000365402	0.932	HLA class I histocompatibility antigen, Cw-7 alpha chain
8	9606.ENSP00000356946	0.928	Low affinity immunoglobulin gamma Fc region receptor III-A
9	9606.ENSP00000365817	0.924	HLA class I histocompatibility antigen, alpha chain E
10	9606.ENSP00000433642	0.924	Low affinity immunoglobulin gamma Fc region receptor III-B
11	9606.ENSP00000351497	0.910	Low affinity immunoglobulin gamma Fc region receptor II-b
12	9606.ENSP00000337838	0.899	Reticulon-4
13	9606.ENSP00000271450	0.862	Low affinity immunoglobulin gamma Fc region receptor II-a
14	9606.ENSP00000358165	0.858	High affinity immunoglobulin gamma Fc receptor I
15	9606.ENSP00000329507	0.846	CMRF35-like molecule 6
16	9606.ENSP00000364907	0.830	Tyrosine-protein kinase SYK
17	9606.ENSP00000371194	0.817	Lymphocyte-specific protein 1
18	9606.ENSP00000438038	0.803	NKG2-A/NKG2-B type II integral membrane protein
19	9606.ENSP00000371333	0.783	Natural killer cells antigen CD94
20	9606.ENSP00000340944	0.752	Tyrosine-protein phosphatase non-receptor type 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.983	transmembrane signaling receptor activity
GO:0019899	0.948	enzyme binding
GO:0019902	0.935	phosphatase binding
GO:0019903	0.930	protein phosphatase binding
GO:0044877	0.928	protein-containing complex binding
GO:0005102	0.920	signaling receptor binding
GO:0140375	0.902	immune receptor activity
GO:0008157	0.858	protein phosphatase 1 binding
GO:0042287	0.684	MHC protein binding
GO:0042802	0.633	identical protein binding
GO:0046983	0.572	protein dimerization activity
GO:0042803	0.561	protein homodimerization activity
GO:0023029	0.526	MHC class Ib protein binding
GO:0042288	0.523	MHC class I protein binding
GO:0032393	0.513	MHC class I receptor activity
GO:0023023	0.484	MHC protein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0009987	0.991	cellular process
GO:0051239	0.990	regulation of multicellular organismal process
GO:0002683	0.988	negative regulation of immune system process
GO:0048523	0.987	negative regulation of cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0048583	0.977	regulation of response to stimulus
GO:0050865	0.976	regulation of cell activation
GO:0007165	0.975	signal transduction
GO:0002376	0.974	immune system process
GO:0051241	0.972	negative regulation of multicellular organismal process
GO:0007166	0.969	cell surface receptor signaling pathway
GO:0060284	0.967	regulation of cell development
GO:1902105	0.958	regulation of leukocyte differentiation
GO:0002695	0.948	negative regulation of leukocyte activation
GO:0019222	0.947	regulation of metabolic process
GO:0050776	0.946	regulation of immune response
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0051250	0.943	negative regulation of lymphocyte activation
GO:1902106	0.939	negative regulation of leukocyte differentiation
GO:0045670	0.934	regulation of osteoclast differentiation
GO:0032501	0.929	multicellular organismal process
GO:0001817	0.929	regulation of cytokine production
GO:0050867	0.924	positive regulation of cell activation
GO:1903555	0.917	regulation of tumor necrosis factor superfamily cytokine production
GO:0006952	0.914	defense response
GO:0006955	0.911	immune response
GO:0002764	0.906	immune response-regulating signaling pathway
GO:0051251	0.901	positive regulation of lymphocyte activation
GO:0045638	0.897	negative regulation of myeloid cell differentiation
GO:1903037	0.893	regulation of leukocyte cell-cell adhesion
GO:0050863	0.889	regulation of T cell activation
GO:0002703	0.883	regulation of leukocyte mediated immunity
GO:0002768	0.874	immune response-regulating cell surface receptor signaling pathway
GO:0001819	0.868	positive regulation of cytokine production
GO:0002706	0.848	regulation of lymphocyte mediated immunity
GO:0050870	0.848	positive regulation of T cell activation
GO:0032102	0.847	negative regulation of response to external stimulus
GO:0002762	0.844	negative regulation of myeloid leukocyte differentiation
GO:0050670	0.842	regulation of lymphocyte proliferation
GO:0002831	0.841	regulation of response to biotic stimulus
GO:0002698	0.838	negative regulation of immune effector process
GO:0050777	0.838	negative regulation of immune response
GO:0002700	0.835	regulation of production of molecular mediator of immune response
GO:0002822	0.830	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002704	0.819	negative regulation of leukocyte mediated immunity
GO:0031347	0.810	regulation of defense response
GO:0032879	0.807	regulation of localization
GO:0023051	0.790	regulation of signaling
GO:0002707	0.764	negative regulation of lymphocyte mediated immunity
GO:0045088	0.746	regulation of innate immune response
GO:0032680	0.740	regulation of tumor necrosis factor production
GO:0042129	0.724	regulation of T cell proliferation
GO:0001818	0.699	negative regulation of cytokine production
GO:0045619	0.687	regulation of lymphocyte differentiation
GO:0002823	0.678	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0031341	0.671	regulation of cell killing
GO:0050868	0.664	negative regulation of T cell activation
GO:0010959	0.645	regulation of metal ion transport
GO:0001910	0.636	regulation of leukocyte mediated cytotoxicity
GO:0032649	0.635	regulation of type II interferon production
GO:0046634	0.628	regulation of alpha-beta T cell activation
GO:0001775	0.627	cell activation
GO:0051924	0.618	regulation of calcium ion transport
GO:0050672	0.612	negative regulation of lymphocyte proliferation
GO:0032720	0.597	negative regulation of tumor necrosis factor production
GO:0042130	0.595	negative regulation of T cell proliferation
GO:0050778	0.559	positive regulation of immune response
GO:0045321	0.535	leukocyte activation
GO:0051051	0.532	negative regulation of transport
GO:0031348	0.516	negative regulation of defense response
GO:0002699	0.502	positive regulation of immune effector process
GO:0002252	0.489	immune effector process
GO:0046649	0.470	lymphocyte activation
GO:0032502	0.455	developmental process
GO:0042221	0.440	response to chemical
GO:0010646	0.427	regulation of cell communication
GO:0042269	0.424	regulation of natural killer cell mediated cytotoxicity
GO:0048856	0.411	anatomical structure development
GO:0002709	0.390	regulation of T cell mediated immunity
GO:0009607	0.377	response to biotic stimulus
GO:0044419	0.360	biological process involved in interspecies interaction between organisms
GO:0009605	0.359	response to external stimulus
GO:0002832	0.344	negative regulation of response to biotic stimulus
GO:0002718	0.344	regulation of cytokine production involved in immune response
GO:0051707	0.340	response to other organism
GO:0080090	0.323	regulation of primary metabolic process
GO:0051171	0.314	regulation of nitrogen compound metabolic process
GO:0031323	0.311	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.981	cytoplasm
GO:0043227	0.939	membrane-bounded organelle
GO:0012505	0.932	endomembrane system
GO:0009986	0.910	cell surface
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0031982	0.825	vesicle
GO:0031090	0.818	organelle membrane
GO:0097708	0.770	intracellular vesicle
GO:0031410	0.740	cytoplasmic vesicle
GO:0098588	0.729	bounding membrane of organelle
GO:0030659	0.617	cytoplasmic vesicle membrane
GO:0005576	0.423	extracellular region
GO:0005615	0.394	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]