StarFunc result for job id Q8NHM5

User Input

>input (1336 residues)
MAGPQMGGSAEDHPPRKRHAAEKQKKKTVIYTKCFEFESATQRPIDRQRYDENEDLSDVE
EIVSVRGFSLEEKLRSQLYQGDFVHAMEGKDFNYEYVQREALRVPLIFREKDGLGIKMPD
PDFTVRDVKLLVGSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLEFSH
TKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGCFTD
FHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIEL
KQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYY
EMCWYVLERYVYCVTQRSHLTQEYQRESMLIDAPRKPSIDGFSSDSWLEMEEEACDQQPQ
EEEEKDEEGEGRDRAPKPPTDGSTSPTSTPSEDQEALGKKPKAPALRFLKRTLSNESEES
VKSTTLAVDYPKTPTGSPATEVSAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIED
PQALLEGVKNVLKEHADDDPSLAITGVPVVTWPKKTPKNRAVGRPKGKLGPASAVKLAAN
RTTAGARRRRTRCRKCEACLRTECGECHFCKDMKKFGGPGRMKQSCIMRQCIAPVLPHTA
VCLVCGEAGKEDTVEEEEGKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECP
KCNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDE
HSKKVPPDGLLRRKSDDVHLRKKRKYEKPQELSGRKRASSLQTSPGSSSHLSPRPPLGSS
LSPWWRSSLTYFQQQLKPGKEDKLFRKKRRSWKNAEDRMALANKPLRRFKQEPEDELPEA
PPKTRESDHSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSRELSKELNHEIQR
TENSLANENQQPIKSEPESEGEEPKRPPGICERPHRFSKGLNGTPRELRHQLGPSLRSPP
RVISRPPPSVSPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQ
DLCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQ
LSWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTD
NRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLT
AVGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSV
SVQFGQVEEKLLQKLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHM5	1.000	1.000	0.000	1336	1.000	1.000	Q8NHM5.pdb.gz	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
2	AFDB:P40034	0.219	0.576	1.097E-26	492	0.091	0.246	P40034.pdb.gz	JHD1_YEAST JmjC domain-containing histone demethylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JHD1 PE=1 SV=1
3	PDB:6o60C	0.130	0.390	2.564E-12	389	0.059	0.203	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
4	PDB:3al5B	0.140	0.509	1.340E-8	311	0.043	0.186	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
5	PDB:4b7eA	0.134	0.445	2.320E-8	349	0.031	0.117	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
6	PDB:7b5mT	0.144	0.491	3.599E-8	325	0.040	0.163	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
7	PDB:3al5C	0.128	0.507	7.761E-8	284	0.043	0.201	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
8	PDB:7yxgA	0.131	0.480	8.199E-8	313	0.034	0.144	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
9	PDB:5nfnB	0.130	0.471	1.272E-7	318	0.034	0.145	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
10	PDB:4qszA	0.132	0.241	1.868E-7	686	0.033	0.064	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
11	PDB:1a4yA	0.138	0.376	4.748E-7	460	0.033	0.096	1a4yA.pdb.gz
12	PDB:7pmkL	0.105	0.211	1.207E-6	475	0.040	0.112	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	AFDB:Q5EXX3	0.035	0.038	1.619E-2	1203	0.079	0.087	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
14	AFDB:M9NDL7	0.036	0.046	2.962E-2	878	0.076	0.115	M9NDL7.pdb.gz	M9NDL7_DROME RALBP1 associated Eps domain containing, isoform B OS=Drosophila melanogaster OX=7227 GN=Reps PE=1 SV=1
15	AFDB:A0A0R4IQP3	0.033	0.038	1.046E-1	1093	0.078	0.095	A0A0R4IQP3.pdb.gz
16	AFDB:Q9Y3Q4	0.049	0.053	1.715E-1	1203	0.075	0.083	Q9Y3Q4.pdb.gz	HCN4_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1
17	AFDB:Q8T9B8	0.028	0.041	2.256E-1	874	0.077	0.118	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
18	AFDB:Q62130	0.030	0.033	3.313E-1	1189	0.077	0.087	Q62130.pdb.gz	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
19	AFDB:Q84WW4	0.035	0.075	3.698E-1	425	0.052	0.165	Q84WW4.pdb.gz	Q84WW4_ARATH RING finger family protein OS=Arabidopsis thaliana OX=3702 GN=At3g05545 PE=1 SV=1
20	AFDB:O75179	0.030	0.022	3.906E-1	2603	0.073	0.038	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGG3	0.0	1447	704	0.527	1.000	A0A0C4DGG3_HUMAN Lysine demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
2	A0A0R4IH56	0.0	719	1295	0.287	0.297	A0A0R4IH56_DANRE Lysine (K)-specific demethylase 2Aa OS=Danio rerio OX=7955 GN=jhdm1A-b PE=1 SV=1
3	F6P9Q3	0.0	1612	1260	0.641	0.679	F6P9Q3_DANRE Lysine (K)-specific demethylase 2Bb OS=Danio rerio OX=7955 GN=LOC100536129 PE=4 SV=1
4	I3VM53	0.0	807	1162	0.310	0.356	I3VM53_HUMAN F-box and leucine-rich repeat protein 11, isoform CRA_a OS=Homo sapiens OX=9606 GN=KDM2A PE=2 SV=1
5	I3VM54	0.0	806	1145	0.310	0.362	I3VM54_HUMAN Lysine demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=1
6	P59997	0.0	800	1161	0.311	0.358	KDM2A_MOUSE Lysine-specific demethylase 2A OS=Mus musculus OX=10090 GN=Kdm2a PE=1 SV=2
7	Q6P1G2	0.0	2406	1309	0.918	0.937	KDM2B_MOUSE Lysine-specific demethylase 2B OS=Mus musculus OX=10090 GN=Kdm2b PE=1 SV=1
8	Q8NHM5	0.0	2766	1336	1.000	1.000	KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1
9	Q9Y2K7	0.0	807	1162	0.310	0.356	KDM2A_HUMAN Lysine-specific demethylase 2A OS=Homo sapiens OX=9606 GN=KDM2A PE=1 SV=3
10	Q9VHH9	1.16e-128	432	1345	0.149	0.148	JHD1_DROME JmjC domain-containing histone demethylation protein 1 OS=Drosophila melanogaster OX=7227 GN=Kdm2 PE=1 SV=2
11	Q6PB97	3.62e-108	359	674	0.126	0.249	FXL19_MOUSE F-box/LRR-repeat protein 19 OS=Mus musculus OX=10090 GN=Fbxl19 PE=1 SV=1
12	Q6PCT2	4.98e-108	359	694	0.124	0.239	FXL19_HUMAN F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19 PE=1 SV=3
13	Q63ZQ7	4.09e-101	338	619	0.123	0.265	Q63ZQ7_XENLA F-box and leucine-rich repeat protein 19 S homeolog OS=Xenopus laevis OX=8355 GN=fbxl19.S PE=2 SV=1
14	Q9UPP1	2.71e-85	304	1060	0.103	0.129	PHF8_HUMAN Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3
15	H0Y3N9	2.88e-85	303	1049	0.103	0.131	H0Y3N9_HUMAN PHD finger protein 8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=2
16	P0CH95	3.71e-84	300	1032	0.100	0.130	PHF8_DANRE Histone lysine demethylase PHF8 OS=Danio rerio OX=7955 GN=phf8 PE=1 SV=1
17	P0CF52	4.61e-83	286	577	0.107	0.248	KDM7B_DANRE Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1
18	Q5RHD1	7.01e-83	293	875	0.101	0.154	KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2
19	Q3UWM4	1.56e-80	288	940	0.103	0.147	KDM7A_MOUSE Lysine-specific demethylase 7A OS=Mus musculus OX=10090 GN=Kdm7a PE=1 SV=2
20	Q6ZMT4	3.35e-79	284	941	0.100	0.142	KDM7A_HUMAN Lysine-specific demethylase 7A OS=Homo sapiens OX=9606 GN=KDM7A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	0.0062	27.9	Cupin-like domain
2	PF00646 F-box	1.3e-08	45.7	F-box domain
3	PF12937 F-box-like	1.3e-05	36.3	F-box-like
4	PF17811 JHD	5.6e-06	38.1	Jumonji helical domain
5	PF02373 JmjC	0.021	26.7	JmjC domain, hydroxylase
6	PF13516 LRR_6	82	14.7	Leucine Rich repeat
7	PF13855 LRR_8	63	14.8	Leucine rich repeat
8	PF00628 PHD	8.7	17.6	PHD-finger
9	PF16866 PHD_4	7e-23	91.8	PHD-finger
10	PF02008 zf-CXXC	6.4e-11	53.4	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
2	9606.ENSP00000233630	0.999	Polycomb group RING finger protein 1
3	9606.ENSP00000356480	0.998	E3 ubiquitin-protein ligase RING2
4	9606.ENSP00000367705	0.998	BCL-6 corepressor
5	9606.ENSP00000419494	0.986	RING1 and YY1-binding protein
6	9606.ENSP00000437775	0.969	BCL-6 corepressor-like protein 1
7	9606.ENSP00000363787	0.947	E3 ubiquitin-protein ligase RING1
8	9606.ENSP00000328004	0.932	YY1 associated factor 2, isoform CRA_d
9	9606.ENSP00000320147	0.840	Histone-lysine N-methyltransferase EZH2
10	9606.ENSP00000326804	0.777	Cullin-1
11	9606.ENSP00000354724	0.756	Polycomb group RING finger protein 3
12	9606.ENSP00000386759	0.755	Histone-lysine N-methyltransferase SETD2
13	9606.ENSP00000367203	0.752	Lysine-specific demethylase 6A
14	9606.ENSP00000414516	0.751	Protein SSXT
15	9606.ENSP00000382688	0.746	Lysine-specific demethylase 5A
16	9606.ENSP00000383042	0.740	Lysine-specific histone demethylase 1A
17	9606.ENSP00000356234	0.735	Lysine-specific demethylase 5B
18	9606.ENSP00000159111	0.732	Lysine-specific demethylase 4B
19	9606.ENSP00000361473	0.729	Lysine-specific demethylase 4A
20	9606.ENSP00000370710	0.728	Lysine-specific demethylase 4C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0032452	0.999	histone demethylase activity
GO:0016706	0.999	2-oxoglutarate-dependent dioxygenase activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0008270	0.996	zinc ion binding
GO:0051864	0.981	histone H3K36 demethylase activity
GO:0045322	0.950	unmethylated CpG binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.924	regulation of biological process
GO:0050794	0.910	regulation of cellular process
GO:0019222	0.892	regulation of metabolic process
GO:0060255	0.884	regulation of macromolecule metabolic process
GO:0006325	0.883	chromatin organization
GO:0010468	0.861	regulation of gene expression
GO:0080090	0.833	regulation of primary metabolic process
GO:0051171	0.833	regulation of nitrogen compound metabolic process
GO:0031323	0.818	regulation of cellular metabolic process
GO:0019219	0.774	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.760	negative regulation of biological process
GO:0006338	0.744	chromatin remodeling
GO:0008152	0.719	metabolic process
GO:0048518	0.693	positive regulation of biological process
GO:0071704	0.653	organic substance metabolic process
GO:0009889	0.634	regulation of biosynthetic process
GO:0051252	0.622	regulation of RNA metabolic process
GO:0031326	0.606	regulation of cellular biosynthetic process
GO:0044238	0.596	primary metabolic process
GO:0006807	0.572	nitrogen compound metabolic process
GO:0010556	0.572	regulation of macromolecule biosynthetic process
GO:0048523	0.569	negative regulation of cellular process
GO:0043170	0.566	macromolecule metabolic process
GO:0048522	0.566	positive regulation of cellular process
GO:2001141	0.555	regulation of RNA biosynthetic process
GO:0006355	0.548	regulation of DNA-templated transcription
GO:0032502	0.527	developmental process
GO:0032501	0.482	multicellular organismal process
GO:0048856	0.479	anatomical structure development
GO:0007275	0.465	multicellular organism development
GO:0010604	0.450	positive regulation of macromolecule metabolic process
GO:0048731	0.442	system development
GO:0010605	0.368	negative regulation of macromolecule metabolic process
GO:0044237	0.337	cellular metabolic process
GO:0048513	0.330	animal organ development
GO:0031324	0.309	negative regulation of cellular metabolic process
GO:0051172	0.306	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0140513	0.932	nuclear protein-containing complex
GO:0031519	0.704	PcG protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.999	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]