StarFunc result for job id Q8NHP6

User Input

>input (518 residues)
MAENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDE
TLKMLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVKDQK
TILDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDNAFNMSDKTSEDICLQLSRLLES
NRKLEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHP6	1.000	1.000	1.587E-96	518	1.000	1.000	Q8NHP6.pdb.gz	MSPD2_HUMAN Motile sperm domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MOSPD2 PE=1 SV=1
2	AFDB:Q8I935	0.418	0.434	2.255E-37	498	0.230	0.239	Q8I935.pdb.gz	Q8I935_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG32410 PE=1 SV=2
3	AFDB:F4K975	0.402	0.762	5.437E-16	263	0.120	0.236	F4K975.pdb.gz	F4K975_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=MDC12.2 PE=1 SV=1
4	AFDB:Q55CU8	0.384	0.532	5.178E-15	364	0.104	0.148	Q55CU8.pdb.gz	PITC_DICDI Phosphatidylinositol transfer protein 3 OS=Dictyostelium discoideum OX=44689 GN=pitC PE=2 SV=1
5	AFDB:Q06705	0.344	0.430	8.710E-15	408	0.108	0.137	Q06705.pdb.gz	CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSR1 PE=1 SV=1
6	AFDB:Q9HDZ5	0.359	0.473	3.290E-14	388	0.106	0.142	Q9HDZ5.pdb.gz	YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC589.09 PE=4 SV=1
7	AFDB:O44782	0.239	0.452	8.294E-14	245	0.081	0.171	O44782.pdb.gz	O44782_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=vpr-1 PE=1 SV=1
8	PDB:7wvtA	0.338	0.469	3.223E-13	364	0.106	0.151	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
9	AFDB:A0A178W2W3	0.380	0.732	6.641E-13	255	0.073	0.149	A0A178W2W3.pdb.gz	A0A178W2W3_ARATH CRAL-TRIO domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g01630 PE=1 SV=1
10	AFDB:Q6P0D4	0.207	0.424	1.774E-12	246	0.097	0.203	Q6P0D4.pdb.gz
11	AFDB:O95292	0.207	0.430	1.991E-12	243	0.075	0.160	O95292.pdb.gz	VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3
12	PDB:6f0eA	0.335	0.544	7.807E-11	300	0.104	0.180	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
13	PDB:4tlgA	0.335	0.425	1.313E-10	396	0.106	0.139	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
14	PDB:3b7nA	0.332	0.529	2.784E-10	307	0.100	0.169	3b7nA.pdb.gz	Functional anatomy of phospholipid binding and regulation of phosphoinositide homeostasis by proteins of the sec14 superfamily
15	PDB:3w68C	0.315	0.591	6.623E-10	252	0.081	0.167	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
16	PDB:4uybA	0.330	0.417	1.487E-9	401	0.108	0.140	4uybA.pdb.gz
17	PDB:1olmE	0.343	0.434	1.986E-9	397	0.098	0.128	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
18	PDB:4fmmB	0.290	0.436	1.061E-8	325	0.075	0.120	4fmmB.pdb.gz	Dimeric Sfh3 has structural changes in its binding pocket that are associated with a dimer-monomer state transformation induced by substrate binding.
19	PDB:1oizA	0.291	0.521	1.590E-8	265	0.085	0.166	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
20	PDB:4cizA	0.371	0.630	2.674E-8	284	0.073	0.134	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHP6	0.0	1072	518	1.000	1.000	MSPD2_HUMAN Motile sperm domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MOSPD2 PE=1 SV=1
2	R4GMN1	0.0	981	486	0.913	0.973	R4GMN1_HUMAN Motile sperm domain containing 2 OS=Homo sapiens OX=9606 GN=MOSPD2 PE=1 SV=1
3	Q8I935	2.32e-50	181	498	0.228	0.237	Q8I935_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG32410 PE=1 SV=2
4	M9PBR6	2.22e-49	182	654	0.228	0.180	M9PBR6_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG10977 PE=1 SV=1
5	Q8IGR6	3.69e-45	166	445	0.205	0.238	Q8IGR6_DROME RE40017p OS=Drosophila melanogaster OX=7227 GN=CG10977 PE=2 SV=1
6	M9NF21	6.51e-38	142	285	0.139	0.253	M9NF21_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG33523 PE=1 SV=1
7	Q06705	5.86e-19	91.3	408	0.100	0.127	CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSR1 PE=1 SV=1
8	F4K975	7.42e-17	82.8	263	0.124	0.243	F4K975_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=MDC12.2 PE=1 SV=1
9	Q9HDZ5	4.99e-14	76.3	388	0.102	0.137	YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC589.09 PE=4 SV=1
10	Q9UUC2	3.55e-11	67.0	355	0.097	0.141	YGR1_SCHPO CRAL-TRIO domain-containing protein C365.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC365.01 PE=2 SV=1
11	Q55CU8	1.74e-10	65.1	364	0.110	0.157	PITC_DICDI Phosphatidylinositol transfer protein 3 OS=Dictyostelium discoideum OX=44689 GN=pitC PE=2 SV=1
12	Q8I934	6.61e-09	58.2	206	0.071	0.180	Q8I934_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Vap-33B PE=1 SV=1
13	Q8IHC4	6.61e-09	58.2	206	0.071	0.180	Q8IHC4_DROME AT14559p OS=Drosophila melanogaster OX=7227 GN=CG10977 PE=2 SV=1
14	Q8I0D5	1.14e-08	58.2	240	0.071	0.154	Q8I0D5_DROME GH09028p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG33523 PE=1 SV=1
15	Q9VRR4	1.14e-08	58.2	234	0.071	0.158	Q9VRR4_DROME LP10490p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG33523 PE=1 SV=2
16	O95292	3.27e-08	57.0	243	0.089	0.189	VAPB_HUMAN Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3
17	Q53XM7	3.27e-08	57.0	243	0.089	0.189	Q53XM7_HUMAN VAMP (Vesicle-associated membrane protein)-associated protein B and C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=1
18	Q56Z59	9.06e-08	57.0	490	0.112	0.118	PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana OX=3702 GN=PATL3 PE=1 SV=2
19	Q9QY76	5.08e-07	53.1	243	0.095	0.202	VAPB_MOUSE Vesicle-associated membrane protein-associated protein B OS=Mus musculus OX=10090 GN=Vapb PE=1 SV=3
20	Q9SCU1	6.80e-07	53.9	409	0.097	0.122	PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana OX=3702 GN=PATL6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	1.6e-23	94.7	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	0.042	25.5	Divergent CRAL/TRIO domain
3	PF00635 Motile_Sperm	1.1e-18	78.4	MSP (Major sperm protein) domain
4	PF14874 PapD-like	5.2e+02	12.2	Flagellar-associated PapD-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337446	0.930	StAR-related lipid transfer protein 3
2	9606.ENSP00000320291	0.904	Oxysterol-binding protein-related protein 1
3	9606.ENSP00000442770	0.829	GPN-loop GTPase 3
4	9606.ENSP00000263847	0.800	Oxysterol-binding protein 1
5	9606.ENSP00000382349	0.760	Acyl-coenzyme A synthetase ACSM4, mitochondrial
6	9606.ENSP00000278937	0.699	Myelin protein zero-like protein 2
7	9606.ENSP00000359819	0.692	Motile sperm domain-containing protein 1
8	9606.ENSP00000356465	0.688	Ras-related protein Rab-32
9	9606.ENSP00000260385	0.670	Regulator of microtubule dynamics protein 3
10	9606.ENSP00000225567	0.630	Golgi SNAP receptor complex member 2
11	9606.ENSP00000009041	0.627	STARD3 N-terminal-like protein
12	9606.ENSP00000345656	0.626	Vesicle-associated membrane protein-associated protein A
13	9606.ENSP00000320917	0.599	KRI1 homolog
14	9606.ENSP00000408411	0.511	Lysosome-associated membrane glycoprotein 2
15	9606.ENSP00000367049	0.509	Mitotic-spindle organizing protein 1
16	9606.ENSP00000379568	0.506	Acyl-CoA-binding domain-containing protein 5
17	9606.ENSP00000404700	0.505	PRELI domain containing protein 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1902622	0.992	regulation of neutrophil migration
GO:0071675	0.992	regulation of mononuclear cell migration
GO:0071622	0.992	regulation of granulocyte chemotaxis
GO:0002687	0.992	positive regulation of leukocyte migration
GO:0032103	0.975	positive regulation of response to external stimulus
GO:0002690	0.974	positive regulation of leukocyte chemotaxis
GO:1902624	0.972	positive regulation of neutrophil migration
GO:0071677	0.972	positive regulation of mononuclear cell migration
GO:0090022	0.967	regulation of neutrophil chemotaxis
GO:0009987	0.742	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.994	membrane
GO:0031090	0.966	organelle membrane
GO:0071944	0.949	cell periphery
GO:0005886	0.940	plasma membrane
GO:0098588	0.933	bounding membrane of organelle
GO:0031982	0.932	vesicle
GO:0031410	0.913	cytoplasmic vesicle
GO:0030659	0.695	cytoplasmic vesicle membrane
GO:0044232	0.649	organelle membrane contact site
GO:0005829	0.540	cytosol
GO:0099503	0.463	secretory vesicle
GO:0030141	0.450	secretory granule
GO:0140284	0.391	endoplasmic reticulum-endosome membrane contact site
GO:0030667	0.371	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]