StarFunc result for job id Q8NHS0

User Input

>input (232 residues)
MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK
KRSLYDRAGCDSWRAGGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFN
SDRGGRGHGLRGAFSAGFGEFPAFMEAFSSFNMLGCSGGSHTTFSSTSFGGSSSGSSGFK
SVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQLKWMDSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHS0	1.000	1.000	5.231E-40	232	1.000	1.000	Q8NHS0.pdb.gz	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
2	AFDB:A0A0J9YX62	0.416	0.292	8.997E-25	334	0.629	0.437	A0A0J9YX62.pdb.gz	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
3	AFDB:O54946	0.422	0.275	7.223E-24	365	0.621	0.395	O54946.pdb.gz	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
4	AFDB:O35723	0.467	0.449	2.412E-23	242	0.569	0.545	O35723.pdb.gz	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
5	AFDB:Q6DHR2	0.409	0.306	1.060E-22	316	0.625	0.459	Q6DHR2.pdb.gz	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
6	AFDB:A0A1D5NSC8	0.412	0.312	2.410E-21	311	0.569	0.424	A0A1D5NSC8.pdb.gz
7	AFDB:P25686	0.402	0.293	1.248E-19	324	0.517	0.370	P25686.pdb.gz	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
8	AFDB:Q7Z6W7	0.433	0.330	3.532E-17	309	0.440	0.330	Q7Z6W7.pdb.gz	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
9	AFDB:Q9TY07	0.416	0.393	9.463E-14	249	0.366	0.341	Q9TY07.pdb.gz	Q9TY07_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-24 PE=4 SV=3
10	AFDB:E9PH18	0.408	0.446	1.637E-13	211	0.397	0.436	E9PH18.pdb.gz	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
11	PDB:6byrA	0.299	0.173	5.694E-3	405	0.159	0.091	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.277	0.248	6.015E-3	262	0.142	0.126	7x3kA.pdb.gz
13	PDB:5y88T	0.218	0.429	4.829E-2	107	0.142	0.308	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:1fpoA	0.276	0.367	2.500E-1	171	0.056	0.076	1fpoA.pdb.gz
15	PDB:4fhmA	0.138	0.096	1.040	354	0.026	0.017	4fhmA.pdb.gz
16	PDB:2z5eA	0.171	0.299	1.799	122	0.039	0.074	2z5eA.pdb.gz
17	PDB:6tljS	0.144	0.119	2.007	293	0.091	0.072	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
18	PDB:6fszFF	0.109	0.116	2.120	215	0.047	0.051	6fszFF.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
19	PDB:3ul5D	0.067	0.134	2.366	84	0.056	0.155	3ul5D.pdb.gz
20	PDB:7scfA	0.087	0.067	2.366	321	0.034	0.025	7scfA.pdb.gz	Inhibitors of Mycobacterium tuberculosis EgtD target both substrate binding sites to limit hercynine production.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHS0	2.52e-173	477	232	1.000	1.000	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
2	O75190	5.76e-75	231	326	0.591	0.420	DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=2
3	A0A0J9YX62	5.82e-75	232	334	0.591	0.410	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
4	Q7ZW83	1.47e-74	227	237	0.582	0.570	Q7ZW83_DANRE DnaJ (Hsp40) homolog, subfamily B, member 6 OS=Danio rerio OX=7955 GN=dnajb6 PE=2 SV=1
5	C9J2C4	4.84e-74	226	228	0.582	0.592	C9J2C4_HUMAN DnaJ heat shock protein family (Hsp40) member B6 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
6	O35723	7.90e-73	223	242	0.547	0.525	DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus OX=10090 GN=Dnajb3 PE=2 SV=1
7	O54946	1.42e-71	224	365	0.591	0.375	DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus OX=10090 GN=Dnajb6 PE=1 SV=4
8	C9JRD2	6.92e-59	187	228	0.500	0.509	C9JRD2_HUMAN DnaJ heat shock protein family (Hsp40) member B2 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=1
9	P25686	3.55e-58	188	324	0.500	0.358	DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2 PE=1 SV=3
10	Q7Z6W7	3.39e-57	186	309	0.461	0.346	DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens OX=9606 GN=DNAJB7 PE=2 SV=2
11	E9PH18	2.52e-51	167	211	0.379	0.417	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
12	Q6DHR2	2.18e-48	163	316	0.362	0.266	Q6DHR2_DANRE DnaJ heat shock protein family (Hsp40) member B6a OS=Danio rerio OX=7955 GN=zgc:92148 PE=1 SV=1
13	Q9TY07	5.19e-36	129	249	0.392	0.365	Q9TY07_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-24 PE=4 SV=3
14	Q7KQK3	6.14e-31	116	244	0.401	0.381	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
15	Q80ZP0	3.73e-28	108	234	0.349	0.346	Q80ZP0_MOUSE 4930503B20Rik protein OS=Mus musculus OX=10090 GN=4930503B20Rik PE=2 SV=1
16	G5E8V6	4.40e-28	108	231	0.349	0.351	G5E8V6_MOUSE RIKEN cDNA 4930503B20 gene OS=Mus musculus OX=10090 GN=4930503B20Rik PE=4 SV=1
17	Q8I489	1.19e-25	105	402	0.332	0.192	Q8I489_PLAF7 Heat shock protein 40, type II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0501100.1 PE=4 SV=2
18	Q6DEJ4	2.33e-24	100	335	0.250	0.173	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
19	Q864B5	9.24e-24	100	397	0.250	0.146	Q864B5_PIG PDJA1 chaperone OS=Sus scrofa OX=9823 PE=1 SV=1
20	Q8WW22	1.03e-23	99.8	397	0.250	0.146	DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens OX=9606 GN=DNAJA4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	4.1e-25	99.0	DnaJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.795	Heat shock protein family A member 4
2	9606.ENSP00000364802	0.782	Heat shock 70 kDa protein 1A
3	9606.ENSP00000310219	0.757	Heat shock 70 kDa protein 6
4	9606.ENSP00000432083	0.685	Heat shock cognate 71 kDa protein
5	9606.ENSP00000324173	0.665	78 kDa glucose-regulated protein
6	9606.ENSP00000297185	0.664	Stress-70 protein, mitochondrial
7	9606.ENSP00000377298	0.631	Nuclear mitotic apparatus protein 1
8	9606.ENSP00000367623	0.625	Heat shock 70 kDa protein 14
9	9606.ENSP00000321388	0.623	Ankyrin repeat and SOCS box protein 4
10	9606.ENSP00000364805	0.612	Heat shock 70 kDa protein 1-like
11	9606.ENSP00000318687	0.608	Heat shock protein 105 kDa
12	9606.ENSP00000445868	0.604	B-cell CLL/lymphoma 7 protein family member A
13	9606.ENSP00000364801	0.603	Heat shock protein family A member 1B
14	9606.ENSP00000378199	0.597	Heat shock-related 70 kDa protein 2
15	9606.ENSP00000285667	0.596	Heat shock 70 kDa protein 13
16	9606.ENSP00000264606	0.594	Histone deacetylase 4
17	9606.ENSP00000296464	0.594	Heat shock 70 kDa protein 4L
18	9606.ENSP00000478568	0.562	G antigen 2E
19	9606.ENSP00000480020	0.541	Hemogen
20	9606.ENSP00000458018	0.506	Heat shock protein family B member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0051082	0.998	unfolded protein binding
GO:0044183	0.993	protein folding chaperone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0006457	0.925	protein folding
GO:0048523	0.902	negative regulation of cellular process
GO:0044087	0.628	regulation of cellular component biogenesis
GO:0051128	0.504	regulation of cellular component organization
GO:0050896	0.473	response to stimulus
GO:0071840	0.451	cellular component organization or biogenesis
GO:0051129	0.421	negative regulation of cellular component organization
GO:0016043	0.417	cellular component organization
GO:0032502	0.390	developmental process
GO:0032501	0.358	multicellular organismal process
GO:0006950	0.342	response to stress
GO:0048856	0.321	anatomical structure development
GO:0048583	0.314	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.996	cytosol
GO:0012505	0.890	endomembrane system
GO:0070013	0.401	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]