StarFunc result for job id Q8NHS2

User Input

>input (421 residues)
MPTLSVFMDVPLAHKLEGSLLKTYKQDDYPNKIFLAYRVCMTNEGHPWVSLVVQKTRLQI
SQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGDSGAFQLGVQFLR
AWHKDARIVYIISSQKELHGLVFQDMGFTVYEYSVWDPKKLCMDPDILLNVVEQIPHGCV
LVMGNIIDCKLTPSGWAKLMSMIKSKQIFPFFDIPCQGLYTSDLEEDTRILQYFVSQGFE
FFCSQSLSKNFGIYDEGVGMLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSI
LCNPALLGEWKQSLKEVVENIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNSQQ
VEYLVRKKHIYIPKNGQINFSCINANNINYITEGINEAVLLTESSEMCLPKEKKTLIGIK
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK69	0.895	0.912	2.852E-42	413	0.390	0.397	A0A140VK69.pdb.gz	A0A140VK69_HUMAN Aspartate aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P00504	0.892	0.911	2.844E-41	412	0.366	0.374	P00504.pdb.gz	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
3	PDB:2cstA	0.889	0.910	1.112E-40	411	0.366	0.375	2cstA.pdb.gz	Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 A resolution.
4	PDB:3wzfA	0.888	0.907	4.970E-40	412	0.387	0.396	3wzfA.pdb.gz
5	AFDB:Q8IHB4	0.892	0.840	5.998E-40	448	0.363	0.342	Q8IHB4.pdb.gz	Q8IHB4_DROME AT16867p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
6	AFDB:Q22067	0.886	0.913	7.023E-39	408	0.337	0.348	Q22067.pdb.gz	AATC_CAEEL Aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=got-1.2 PE=1 SV=1
7	AFDB:P46645	0.881	0.915	5.966E-38	405	0.290	0.301	P46645.pdb.gz	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
8	AFDB:Q5B082	0.887	0.842	7.795E-38	445	0.318	0.301	Q5B082.pdb.gz	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
9	AFDB:P46644	0.876	0.824	6.985E-37	449	0.287	0.269	P46644.pdb.gz	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
10	AFDB:F4I0D4	0.884	0.918	2.036E-36	405	0.266	0.277	F4I0D4.pdb.gz	F4I0D4_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP4 PE=1 SV=1
11	AFDB:O42652	0.884	0.909	2.148E-36	409	0.292	0.301	O42652.pdb.gz	AATC_SCHPO Aspartate aminotransferase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aat2 PE=1 SV=1
12	PDB:6jpkA	0.876	0.901	1.097E-35	409	0.287	0.296	6jpkA.pdb.gz	Crystal structure of L-aspartate aminotransferase from Schizosaccharomyces pombe.
13	AFDB:P00505	0.884	0.866	1.324E-35	430	0.273	0.267	P00505.pdb.gz	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
14	PDB:3pd6A	0.874	0.915	1.429E-34	401	0.283	0.297	3pd6A.pdb.gz	Biochemical and structural characterization of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-IV.
15	PDB:7aatA	0.871	0.912	1.970E-34	401	0.266	0.279	7aatA.pdb.gz	X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
16	PDB:4f5fB	0.863	0.906	9.291E-34	400	0.271	0.285	4f5fB.pdb.gz
17	PDB:3fslA	0.867	0.917	1.669E-32	397	0.235	0.249	3fslA.pdb.gz	Crystal structure of tyrosine aminotransferase tripple mutant (P181Q,R183G,A321K) from Escherichia coli at 2.35 A resolution
18	PDB:1yaaA	0.866	0.884	3.005E-32	412	0.257	0.262	1yaaA.pdb.gz	Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase.
19	PDB:4eu1A	0.835	0.914	1.578E-31	383	0.249	0.274	4eu1A.pdb.gz
20	PDB:3b46B	0.656	0.650	6.054E-14	425	0.135	0.134	3b46B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK69	1.83e-105	320	413	0.392	0.400	A0A140VK69_HUMAN Aspartate aminotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P17174	1.83e-105	320	413	0.392	0.400	AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3
3	P13221	2.86e-104	317	413	0.390	0.397	AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Got1 PE=1 SV=3
4	P05201	6.65e-104	316	413	0.387	0.395	AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus OX=10090 GN=Got1 PE=1 SV=3
5	P00504	6.68e-103	313	412	0.368	0.376	AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus OX=9031 GN=GOT1 PE=1 SV=3
6	Q8IHB4	6.29e-90	281	448	0.368	0.346	Q8IHB4_DROME AT16867p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
7	A1ZAA5	8.17e-90	280	437	0.368	0.355	A1ZAA5_DROME Glutamate oxaloacetate transaminase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Got1 PE=1 SV=1
8	Q7K221	1.72e-89	279	416	0.366	0.370	Q7K221_DROME Glutamate oxaloacetate transaminase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Got1 PE=1 SV=1
9	Q7YWB4	1.89e-89	279	416	0.366	0.370	Q7YWB4_DROME Aminotransferase OS=Drosophila melanogaster OX=7227 GN=Got1 PE=2 SV=1
10	Q22067	1.45e-80	256	408	0.344	0.355	AATC_CAEEL Aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=got-1.2 PE=1 SV=1
11	Q5B082	6.51e-78	250	445	0.316	0.299	Q5B082_EMENI Aspartate transaminase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06048 PE=3 SV=1
12	O42652	7.72e-68	223	409	0.290	0.298	AATC_SCHPO Aspartate aminotransferase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aat2 PE=1 SV=1
13	P46645	9.14e-66	217	405	0.299	0.311	AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana OX=3702 GN=ASP2 PE=1 SV=2
14	P12345	1.57e-64	214	430	0.280	0.274	AATM_RABIT Aspartate aminotransferase, mitochondrial OS=Oryctolagus cuniculus OX=9986 GN=GOT2 PE=1 SV=2
15	P00507	8.60e-64	213	430	0.280	0.274	AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Got2 PE=1 SV=2
16	P05202	9.77e-64	213	430	0.280	0.274	AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1
17	P00505	6.92e-62	207	430	0.273	0.267	AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3
18	F4I0D4	2.63e-61	206	405	0.266	0.277	F4I0D4_ARATH Aspartate aminotransferase OS=Arabidopsis thaliana OX=3702 GN=ASP4 PE=1 SV=1
19	P46644	3.67e-61	206	449	0.283	0.265	AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASP3 PE=1 SV=1
20	P00508	1.46e-60	204	423	0.264	0.262	AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus OX=9031 GN=GOT2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	2e-21	88.2	Aminotransferase class I and II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438144	0.941	Malate dehydrogenase, cytoplasmic
2	9606.ENSP00000327070	0.936	Malate dehydrogenase, mitochondrial
3	9606.ENSP00000277865	0.935	Glutamate dehydrogenase 1, mitochondrial
4	9606.ENSP00000327589	0.935	Glutamate dehydrogenase 2, mitochondrial
5	9606.ENSP00000364490	0.929	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
6	9606.ENSP00000359976	0.928	Cystathionine gamma-lyase
7	9606.ENSP00000333019	0.926	Adenylosuccinate synthetase isozyme 1
8	9606.ENSP00000355493	0.926	Adenylosuccinate synthetase isozyme 2
9	9606.ENSP00000175506	0.924	Asparagine synthetase
10	9606.ENSP00000289004	0.924	4-hydroxyphenylpyruvate dioxygenase
11	9606.ENSP00000361471	0.921	Argininosuccinate synthase
12	9606.ENSP00000264705	0.919	CAD protein
13	9606.ENSP00000359680	0.917	4-hydroxy-2-oxoglutarate aldolase, mitochondrial
14	9606.ENSP00000380402	0.916	3-mercaptopyruvate sulfurtransferase
15	9606.ENSP00000385828	0.916	Thiosulfate sulfurtransferase
16	9606.ENSP00000370571	0.914	Tyrosine 3-monooxygenase
17	9606.ENSP00000448059	0.914	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
18	9606.ENSP00000260508	0.912	Kynurenine--oxoglutarate transaminase 3
19	9606.ENSP00000318820	0.912	Thyroid peroxidase
20	9606.ENSP00000399415	0.912	Kynurenine--oxoglutarate transaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004069	0.999	L-aspartate:2-oxoglutarate aminotransferase activity
GO:0042802	0.469	identical protein binding
GO:0097159	0.338	organic cyclic compound binding
GO:1901363	0.325	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.917	nitrogen compound metabolic process
GO:0044281	0.846	small molecule metabolic process
GO:1901564	0.824	organonitrogen compound metabolic process
GO:0009058	0.700	biosynthetic process
GO:1901576	0.497	organic substance biosynthetic process
GO:0019752	0.489	carboxylic acid metabolic process
GO:0044249	0.410	cellular biosynthetic process
GO:1901605	0.307	alpha-amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.972	cytosol
GO:0043227	0.966	membrane-bounded organelle
GO:0043231	0.946	intracellular membrane-bounded organelle
GO:0070013	0.573	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21824	0.999	2-oxoglutarate + L-aspartate = L-glutamate + oxaloacetate
EC:2.6.1.1	0.999	aspartate transaminase.

[back to server]