StarFunc result for job id Q8NHS3

User Input

>input (518 residues)
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSI
WPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCL
YAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGF
ILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSAFLGILNIILILAILREHRVDDS
GRQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTLFIFALFETIITPLTMDMYAW
TQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVGFFILLPWGNQ
FPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFL
TSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWG
PRWAFSLVCGIIVLTITLLGVVYKRLIALSVRYGRIQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHS3	1.000	1.000	2.199E-69	518	1.000	1.000	Q8NHS3.pdb.gz	MFSD8_HUMAN Major facilitator superfamily domain-containing protein 8 OS=Homo sapiens OX=9606 GN=MFSD8 PE=1 SV=1
2	AFDB:Q8BH31	0.934	0.933	1.484E-59	519	0.817	0.815	Q8BH31.pdb.gz	MFSD8_MOUSE Major facilitator superfamily domain-containing protein 8 OS=Mus musculus OX=10090 GN=Mfsd8 PE=2 SV=1
3	AFDB:Q9VS51	0.831	0.789	8.173E-31	546	0.332	0.315	Q9VS51.pdb.gz	Q9VS51_DROME Cln7, isoform A OS=Drosophila melanogaster OX=7227 GN=Cln7 PE=1 SV=2
4	AFDB:Q8T2G9	0.766	0.796	7.651E-24	498	0.282	0.293	Q8T2G9.pdb.gz	Q8T2G9_DICDI Major facilitator superfamily (MFS) profile domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272192 PE=4 SV=2
5	AFDB:Q9T050	0.616	0.463	1.669E-13	707	0.189	0.139	Q9T050.pdb.gz	SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana OX=3702 GN=At4g11810 PE=3 SV=1
6	AFDB:F4I0G7	0.629	0.473	3.404E-13	708	0.185	0.136	F4I0G7.pdb.gz	F4I0G7_ARATH Major Facilitator Superfamily with SPX (SYG1/Pho81/XPR1) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=VPT1 PE=1 SV=1
7	AFDB:P25744	0.651	0.815	3.701E-13	408	0.153	0.194	P25744.pdb.gz	MDTG_ECOLI Multidrug resistance protein MdtG OS=Escherichia coli (strain K12) OX=83333 GN=mdtG PE=3 SV=1
8	AFDB:F4JMQ7	0.614	0.469	6.655E-13	700	0.183	0.136	F4JMQ7.pdb.gz	F4JMQ7_ARATH Major Facilitator Superfamily with SPX (SYG1/Pho81/XPR1) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=PHT5 PE=1 SV=1
9	AFDB:Q18797	0.609	0.747	3.009E-12	415	0.181	0.227	Q18797.pdb.gz	Q18797_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C53B4.3 PE=1 SV=3
10	PDB:6s4mA	0.620	0.747	6.603E-12	426	0.168	0.204	6s4mA.pdb.gz
11	AFDB:Q96BI1	0.621	0.749	8.228E-12	424	0.172	0.210	Q96BI1.pdb.gz	S22AI_HUMAN Solute carrier family 22 member 18 OS=Homo sapiens OX=9606 GN=SLC22A18 PE=1 SV=3
12	PDB:7sptA	0.605	0.661	1.055E-8	470	0.127	0.140	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:7bc7A	0.594	0.703	1.979E-8	432	0.106	0.127	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
14	PDB:4ybqB	0.588	0.651	2.767E-8	462	0.137	0.154	4ybqB.pdb.gz
15	PDB:3o7qA	0.594	0.727	3.710E-8	414	0.106	0.133	3o7qA.pdb.gz
16	PDB:6thaA	0.555	0.631	5.188E-8	448	0.127	0.147	6thaA.pdb.gz
17	PDB:7oixB	0.576	0.652	8.946E-8	451	0.125	0.144	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
18	PDB:7wsmA	0.548	0.604	1.479E-7	464	0.133	0.149	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
19	PDB:4gbyA	0.587	0.635	4.045E-7	475	0.135	0.147	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
20	PDB:6wbvA	0.574	0.678	4.399E-7	429	0.129	0.156	6wbvA.pdb.gz	Structure of hepcidin-bound ferroportin reveals iron homeostatic mechanisms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z2P8	0.0	959	473	0.911	0.998	B7Z2P8_HUMAN cDNA FLJ51842 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q8BH31	0.0	877	519	0.817	0.815	MFSD8_MOUSE Major facilitator superfamily domain-containing protein 8 OS=Mus musculus OX=10090 GN=Mfsd8 PE=2 SV=1
3	Q8NHS3	0.0	1056	518	1.000	1.000	MFSD8_HUMAN Major facilitator superfamily domain-containing protein 8 OS=Homo sapiens OX=9606 GN=MFSD8 PE=1 SV=1
4	Q9VS51	3.87e-100	314	546	0.332	0.315	Q9VS51_DROME Cln7, isoform A OS=Drosophila melanogaster OX=7227 GN=Cln7 PE=1 SV=2
5	Q8T2G9	9.57e-46	169	498	0.303	0.315	Q8T2G9_DICDI Major facilitator superfamily (MFS) profile domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272192 PE=4 SV=2
6	Q9T050	7.83e-05	47.8	707	0.116	0.085	SPXM2_ARATH SPX domain-containing membrane protein At4g11810 OS=Arabidopsis thaliana OX=3702 GN=At4g11810 PE=3 SV=1
7	F4JMQ7	8.51e-05	47.8	700	0.089	0.066	F4JMQ7_ARATH Major Facilitator Superfamily with SPX (SYG1/Pho81/XPR1) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=PHT5 PE=1 SV=1
8	Q9D2V8	1.53e-04	46.6	456	0.120	0.136	MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus OX=10090 GN=Mfsd10 PE=1 SV=1
9	F4I0G7	6.93e-04	44.7	708	0.095	0.069	F4I0G7_ARATH Major Facilitator Superfamily with SPX (SYG1/Pho81/XPR1) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=VPT1 PE=1 SV=1
10	P25351	0.001	43.5	611	0.073	0.062	YCR3_YEAST Major facilitator superfamily domain-containing protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCR023C PE=1 SV=2
11	Q18797	0.003	42.7	415	0.112	0.140	Q18797_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C53B4.3 PE=1 SV=3
12	Q10072	0.004	42.4	589	0.073	0.065	YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H1.06c PE=3 SV=1
13	P36035	0.005	42.0	616	0.087	0.073	JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=JEN1 PE=1 SV=1
14	Q38DC2	0.007	41.6	591	0.054	0.047	Q38DC2_TRYB2 Transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3870 PE=4 SV=1
15	P77726	0.012	40.4	454	0.079	0.090	YAJR_ECOLI Inner membrane transport protein YajR OS=Escherichia coli (strain K12) OX=83333 GN=yajR PE=1 SV=2
16	B0JYP2	0.020	40.0	517	0.068	0.068	B0JYP2_BOVIN Solute carrier family 18 (Vesicular monoamine), member 2 OS=Bos taurus OX=9913 GN=SLC18A2 PE=2 SV=1
17	Q14728	0.022	39.7	455	0.102	0.116	MFS10_HUMAN Major facilitator superfamily domain-containing protein 10 OS=Homo sapiens OX=9606 GN=MFSD10 PE=1 SV=1
18	Q27963	0.024	39.7	517	0.068	0.068	VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus OX=9913 GN=SLC18A2 PE=1 SV=1
19	Q8BRU6	0.027	39.7	517	0.068	0.068	VMAT2_MOUSE Synaptic vesicular amine transporter OS=Mus musculus OX=10090 GN=Slc18a2 PE=1 SV=1
20	P9WJY3	0.038	38.9	518	0.062	0.062	MFS55_MYCTU Probable triacylglyceride transporter Rv1410c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1410c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	5.7e-34	129.2	Major Facilitator Superfamily
2	PF00083 Sugar_tr	3e-07	41.3	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296468

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249806	0.888	CLN6, transmembrane ER protein
2	9606.ENSP00000485589	0.866	Battenin isoform d
3	9606.ENSP00000454229	0.865	Battenin
4	9606.ENSP00000366673	0.855	Ceroid-lipofuscinosis neuronal protein 5
5	9606.ENSP00000328182	0.819	Protein CLN8
6	9606.ENSP00000299427	0.808	Tripeptidyl-peptidase 1
7	9606.ENSP00000394863	0.799	Palmitoyl-protein thioesterase 1
8	9606.ENSP00000332646	0.778	Major facilitator superfamily domain-containing protein 10
9	9606.ENSP00000464932	0.767	UNC93-like protein MFSD11
10	9606.ENSP00000275532	0.750	BTB/POZ domain-containing protein KCTD7
11	9606.ENSP00000442688	0.740	Molybdate-anion transporter
12	9606.ENSP00000479104	0.737	Synaptic vesicle 2-related protein
13	9606.ENSP00000354111	0.735	DnaJ homolog subfamily C member 5
14	9606.ENSP00000405482	0.733	Putative transporter SVOPL
15	9606.ENSP00000270861	0.724	Serine/threonine-protein kinase PLK4
16	9606.ENSP00000301327	0.724	Major facilitator superfamily domain containing 3
17	9606.ENSP00000357840	0.721	Sodium-dependent glucose transporter 1
18	9606.ENSP00000310832	0.696	Cathepsin F
19	9606.ENSP00000334003	0.694	Protein inturned
20	9606.ENSP00000411096	0.678	ATP binding cassette subfamily A member 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.998	transmembrane transporter activity
GO:0022804	0.465	active transmembrane transporter activity
GO:0015291	0.459	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.991	biological regulation
GO:0008152	0.976	metabolic process
GO:0023052	0.946	signaling
GO:0050789	0.943	regulation of biological process
GO:0050794	0.917	regulation of cellular process
GO:0044237	0.873	cellular metabolic process
GO:0007154	0.872	cell communication
GO:0019222	0.813	regulation of metabolic process
GO:0032502	0.739	developmental process
GO:0048856	0.699	anatomical structure development
GO:0032501	0.689	multicellular organismal process
GO:0050896	0.687	response to stimulus
GO:0051171	0.682	regulation of nitrogen compound metabolic process
GO:0080090	0.681	regulation of primary metabolic process
GO:0060255	0.662	regulation of macromolecule metabolic process
GO:0071840	0.648	cellular component organization or biogenesis
GO:0016043	0.607	cellular component organization
GO:0031323	0.586	regulation of cellular metabolic process
GO:0007275	0.531	multicellular organism development
GO:0071704	0.502	organic substance metabolic process
GO:0051179	0.498	localization
GO:0006810	0.465	transport
GO:0048731	0.452	system development
GO:0007033	0.409	vacuole organization
GO:0051716	0.396	cellular response to stimulus
GO:0009056	0.368	catabolic process
GO:0007399	0.367	nervous system development
GO:0007040	0.352	lysosome organization
GO:0048869	0.341	cellular developmental process
GO:0044248	0.338	cellular catabolic process
GO:0044238	0.327	primary metabolic process
GO:0043933	0.318	protein-containing complex organization
GO:0007165	0.315	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005764	1.000	lysosome
GO:0005765	0.991	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]