StarFunc result for job id Q8NHU2

User Input

>input (1237 residues)
MSVLTSPRGKVEVVHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCND
KEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGNIPCLTYEEDFAVHICHRHSHY
PQLHVRKARVEDHDDLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVEGTAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQDLSVRRSQDAELRSSSQGSQKI
VEELQEPVSPDTMENIQGNIAREAASEEALTAVQSGNVSEPEDIEKLSDISTGYAQYHHV
SSRSLASLVLPEEPVHFRPIYRGASAAFCIQLFCIDEKYEARSLDFMNFVFSLFSDKNFC
VISLPHLTPEFFLIQNFVKMVPFNTCTLEQDLYVFHRAGLLKSINIRFATLLDTPGVENL
VSTLMLNKSILEDLDRYNKARKDPDGTLLQAFVAEVAEQIVGIAVIRNEMDIEYIRSHYN
IEDFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYRVYPKSREGKF
QNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDPMSYALNHTNRKLTLEP
KITVNAKIIVVGASSVGISFLETLVFCSHMKFNNLTLISTHGLPGKKLLDTEQRKFLASD
HCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCP
TEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTEGNIIVY
GNTIDTYTTVETLLNLGVSGSRIHLVQPPPASTITCINNYSVESAVADALGAAGVTMYRD
AILAQWNDGLHPDPIYSASFTTPTKPFRLQCSMFFSFCEKNVDYETFKALNDACLVYDSR
LVIDTNFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPTLEP
VTEPPANLDRLIPMYKGAKIQGGILPGSYHYLHIAKPAIPTPLEVQMAQPNYGLELVTGS
AKNGTYFRIHINKYKMVETITCLSREPFPASNYIRLFGQHEQLLNNLCARYDENLITDLY
SYFTEPWCLALFHDRFIDLRKELRQILASKEEEDLPSIEQLAHQIEDEEINPTEKPRQYL
KRVFEESIYKTLVERSTLDYLHYNRYHLPMYAWPGIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q23F13	0.771	0.571	4.630E-79	1699	0.250	0.182	Q23F13.pdb.gz	CFA61_TETTS Cilia- and flagella-associated protein 61 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=CFAP61 PE=4 SV=1
2	AFDB:A8IF44	0.711	0.762	9.287E-79	1147	0.238	0.256	A8IF44.pdb.gz	CFA61_CHLRE Cilia- and flagella-associated protein 61 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP61 PE=1 SV=1
3	PDB:1q1wA	0.242	0.631	1.183E-17	422	0.054	0.159	1q1wA.pdb.gz	Crystal structure of putidaredoxin reductase from Pseudomonas putida, the final structural component of the cytochrome P450cam monooxygenase.
4	PDB:2v3aA	0.237	0.672	6.971E-16	381	0.051	0.165	2v3aA.pdb.gz	Crystal Structure of the Electron Transfer Complex Rubredoxin - Rubredoxin Reductase from Pseudomonas Aeruginosa.
5	PDB:5jciA	0.254	0.660	8.370E-15	432	0.048	0.137	5jciA.pdb.gz	Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
6	PDB:3kljA	0.215	0.597	5.266E-14	378	0.049	0.159	3kljA.pdb.gz	Crystal structure of NADH:rubredoxin oxidoreductase from Clostridium acetobutylicum: a key component of the dioxygen scavenging system in obligatory anaerobes.
7	PDB:7kmyA	0.236	0.557	8.954E-13	465	0.054	0.144	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions
8	PDB:1gerB	0.240	0.578	1.148E-12	449	0.056	0.154	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.
9	PDB:3hyvA	0.228	0.562	1.268E-12	429	0.050	0.145	3hyvA.pdb.gz	The structure of Aquifex aeolicus sulfide:quinone oxidoreductase, a basis to understand sulfide detoxification and respiration
10	PDB:6zk7AAAA	0.202	0.510	2.420E-12	425	0.045	0.132	6zk7AAAA.pdb.gz	The oxidoreductase PYROXD1 uses NAD(P) + as an antioxidant to sustain tRNA ligase activity in pre-tRNA splicing and unfolded protein response.
11	PDB:3eanD	0.246	0.559	2.809E-12	491	0.045	0.114	3eanD.pdb.gz	Crystal structure and catalysis of the selenoprotein thioredoxin reductase 1.
12	PDB:5yjyB	0.220	0.530	5.101E-12	465	0.045	0.120	5yjyB.pdb.gz	Ubiquinone binding site of yeast NADH dehydrogenase revealed by structures binding novel competitive- and mixed-type inhibitors
13	AFDB:Q14AW5	0.034	0.055	1.076	724	0.034	0.058	Q14AW5.pdb.gz	NSUN7_MOUSE Putative methyltransferase NSUN7 OS=Mus musculus OX=10090 GN=Nsun7 PE=2 SV=2
14	AFDB:Q8H0Z6	0.041	0.062	1.859	664	0.038	0.071	Q8H0Z6.pdb.gz	IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana OX=3702 GN=IP5P3 PE=1 SV=1
15	AFDB:O08792	0.045	0.072	2.157	575	0.032	0.070	O08792.pdb.gz	COE2_MOUSE Transcription factor COE2 OS=Mus musculus OX=10090 GN=Ebf2 PE=1 SV=4
16	AFDB:P79832	0.033	0.047	2.504	723	0.023	0.040	P79832.pdb.gz	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
17	AFDB:E7FFX1	0.037	0.048	3.375	844	0.023	0.033	E7FFX1.pdb.gz	NPS4B_DANRE Neuronal PAS domain-containing protein 4B OS=Danio rerio OX=7955 GN=npas4b PE=3 SV=1
18	AFDB:Q555V8	0.088	0.097	3.375	1112	0.018	0.020	Q555V8.pdb.gz	Q555V8_DICDI Acetylglutamate kinase OS=Dictyostelium discoideum OX=44689 GN=argB PE=4 SV=2
19	AFDB:Q8T088	0.021	0.045	3.375	498	0.016	0.040	Q8T088.pdb.gz	WDR55_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=CG14722 PE=2 SV=1
20	AFDB:A0A024R704	0.033	0.047	3.547	688	0.027	0.049	A0A024R704.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8IF44	8.85e-66	246	1147	0.171	0.184	CFA61_CHLRE Cilia- and flagella-associated protein 61 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP61 PE=1 SV=1
2	Q23F13	9.18e-42	170	1699	0.101	0.074	CFA61_TETTS Cilia- and flagella-associated protein 61 OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=CFAP61 PE=4 SV=1
3	Q8IJJ4	0.37	37.4	640	0.025	0.048	Q8IJJ4_PLAF7 Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1020800 PE=3 SV=2
4	Q8BUE4	2.0	34.7	373	0.012	0.040	FSP1_MOUSE Ferroptosis suppressor protein 1 OS=Mus musculus OX=10090 GN=Aifm2 PE=1 SV=1
5	P38851	2.1	35.0	1228	0.022	0.022	LAM1_YEAST Membrane-anchored lipid-binding protein LAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM1 PE=1 SV=1
6	Q54XP9	2.6	34.7	1297	0.027	0.026	Q54XP9_DICDI Centrosomal protein 148 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278809 PE=4 SV=1
7	Q90268	2.7	34.3	410	0.033	0.100	PAX2A_DANRE Paired box protein Pax-2a OS=Danio rerio OX=7955 GN=pax2a PE=2 SV=2
8	P60293	5.2	33.5	440	0.022	0.061	MUKF_ECOLI Chromosome partition protein MukF OS=Escherichia coli (strain K12) OX=83333 GN=mukF PE=1 SV=1
9	Q9BRQ8	5.3	33.5	373	0.015	0.048	FSP1_HUMAN Ferroptosis suppressor protein 1 OS=Homo sapiens OX=9606 GN=AIFM2 PE=1 SV=1
10	P22944	5.4	33.9	1104	0.031	0.034	NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=niiA PE=3 SV=2
11	Q38B12	5.8	33.5	791	0.019	0.030	Q38B12_TRYB2 Xrn1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0980 PE=4 SV=1
12	Q9W596	8.2	33.5	5495	0.018	0.004	FUTSC_DROME Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4
13	P38798	9.7	33.1	1089	0.017	0.019	NMD2_YEAST Nonsense-mediated mRNA decay protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16092 CFAP61_N	1.6e-87	305.2	Cilia- and flagella-associated protein 61, N-terminal domain
2	PF07992 Pyr_redox_2	77	14.0	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273390	0.952	Cilia- and flagella-associated protein 91
2	9606.ENSP00000288912	0.886	Cilia- and flagella-associated protein 251
3	9606.ENSP00000358575	0.861	May regulate cilium motility through its role in the assembly of the axonemal radial spokes
4	9606.ENSP00000252655	0.794	Radial spoke head protein 3 homolog
5	9606.ENSP00000335636	0.778	N-alpha-acetyltransferase 20
6	9606.ENSP00000456850	0.738	Testicular haploid expressed gene protein-like
7	9606.ENSP00000358718	0.716	Cilia and flagella associated protein 58
8	9606.ENSP00000440207	0.714	TBC1 domain family member 30
9	9606.ENSP00000333519	0.710	Sodium/potassium/calcium exchanger 3
10	9606.ENSP00000275034	0.707	PH-interacting protein
11	9606.ENSP00000450337	0.697	Liprin-alpha-2
12	9606.ENSP00000361596	0.696	Neuralized-like protein 2
13	9606.ENSP00000355260	0.694	Protein phosphatase 1 regulatory subunit 14C
14	9606.ENSP00000323275	0.689	Dynein assembly factor 4, axonemal
15	9606.ENSP00000358956	0.686	Interleukin-1 receptor-associated kinase 1-binding protein 1
16	9606.ENSP00000344749	0.684	Cilia- and flagella-associated protein 100
17	9606.ENSP00000262498	0.677	Cilia- and flagella-associated protein 20
18	9606.ENSP00000449535	0.677	Acyl-CoA synthetase short-chain family member 3, mitochondrial
19	9606.ENSP00000405708	0.668	Coiled-coil domain-containing protein 39
20	9606.ENSP00000255006	0.667	Ras and Rab interactor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.761	catalytic activity
GO:0097159	0.371	organic cyclic compound binding
GO:1901363	0.369	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0007017	0.584	microtubule-based process
GO:0007018	0.369	microtubule-based movement
GO:0003341	0.337	cilium movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.885	intracellular organelle
GO:0005929	0.844	cilium
GO:0031514	0.778	motile cilium
GO:0043232	0.439	intracellular non-membrane-bounded organelle
GO:0016020	0.371	membrane
GO:0043231	0.311	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]