StarFunc result for job id Q8NHU3

User Input

>input (365 residues)
MDIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYI
QIAMPTESRNKFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY
IDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLP
VPGMHFQCAPKLNGDSQAKVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFI
KEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNL
KVSSQTNFLSRAWWFPIFYFFEKNVQGSIPCCFSWPLSWPPGCFKSSCKKYSRVQKIGED
NEKST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4JM44	0.846	0.846	3.051E-49	365	0.910	0.910	Q4JM44.pdb.gz	SMS2_RAT Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Rattus norvegicus OX=10116 GN=Sgms2 PE=1 SV=2
2	AFDB:Q7TSX5	0.778	0.680	4.995E-37	419	0.570	0.496	Q7TSX5.pdb.gz	SMS1_RAT Phosphatidylcholine:ceramide cholinephosphotransferase 1 OS=Rattus norvegicus OX=10116 GN=Sgms1 PE=2 SV=2
3	AFDB:A0A5F9ZGS6	0.710	0.545	7.644E-24	478	0.345	0.264	A0A5F9ZGS6.pdb.gz	A0A5F9ZGS6_HUMAN Sterile alpha motif domain containing 8 OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=1
4	AFDB:Q9VS60	0.685	0.421	2.460E-21	600	0.345	0.210	Q9VS60.pdb.gz	SMSR1_DROME Ceramide phosphoethanolamine synthase OS=Drosophila melanogaster OX=7227 GN=SMSr PE=1 SV=2
5	AFDB:Q38E56	0.549	0.549	6.864E-10	365	0.219	0.219	Q38E56.pdb.gz	SLS4_TRYB2 Phosphatidylcholine:ceramide cholinephosphotransferase 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SLS4 PE=3 SV=1
6	AFDB:Q9SH93	0.500	0.590	9.118E-8	305	0.123	0.148	Q9SH93.pdb.gz	IPCS2_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=IPCS2 PE=1 SV=1
7	AFDB:E9AFX2	0.523	0.562	2.314E-7	338	0.164	0.178	E9AFX2.pdb.gz	SLS_LEIMA Phosphatidylinositol:ceramide inositolphosphotransferase OS=Leishmania major OX=5664 GN=IPCS PE=3 SV=1
8	AFDB:Q0E949	0.151	0.094	1.370E-2	702	0.137	0.071	Q0E949.pdb.gz	Q0E949_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=RalGPS PE=4 SV=1
9	AFDB:O59785	0.155	0.126	2.396E-2	505	0.129	0.093	O59785.pdb.gz	YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC320.08 PE=1 SV=1
10	AFDB:P04817	0.143	0.099	2.396E-2	590	0.173	0.107	P04817.pdb.gz	CAN1_YEAST Arginine permease CAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAN1 PE=1 SV=2
11	PDB:5jwyA	0.276	0.371	1.037E-1	259	0.099	0.139	5jwyA.pdb.gz	Structural Insight into Substrate Selection and Catalysis of Lipid Phosphate Phosphatase PgpB in the Cell Membrane.
12	PDB:4djiA	0.133	0.109	5.292E-1	493	0.093	0.069	4djiA.pdb.gz
13	PDB:7rkfR	0.117	0.135	8.047E-1	296	0.126	0.155	7rkfR.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
14	PDB:1f88B	0.169	0.194	8.431E-1	305	0.110	0.131	1f88B.pdb.gz	Crystal structure of rhodopsin: A G protein-coupled receptor.
15	PDB:3puxG	0.156	0.183	9.254E-1	293	0.096	0.119	3puxG.pdb.gz	Snapshots of the maltose transporter during ATP hydrolysis.
16	PDB:7d10A	0.112	0.102	9.254E-1	446	0.126	0.103	7d10A.pdb.gz
17	PDB:6ibbA	0.141	0.157	9.695E-1	301	0.110	0.133	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
18	PDB:5k3jA	0.115	0.076	1.115	662	0.090	0.050	5k3jA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
19	PDB:8dwcR	0.135	0.171	1.115	250	0.101	0.148	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
20	PDB:7wffA	0.115	0.126	1.343	305	0.110	0.131	7wffA.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4JM44	0.0	709	365	0.910	0.910	SMS2_RAT Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Rattus norvegicus OX=10116 GN=Sgms2 PE=1 SV=2
2	Q8NHU3	0.0	758	365	1.000	1.000	SMS2_HUMAN Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Homo sapiens OX=9606 GN=SGMS2 PE=1 SV=1
3	Q9D4B1	0.0	711	365	0.915	0.915	SMS2_MOUSE Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Mus musculus OX=10090 GN=Sgms2 PE=1 SV=2
4	Q8VCQ6	5.19e-159	454	419	0.592	0.516	SMS1_MOUSE Phosphatidylcholine:ceramide cholinephosphotransferase 1 OS=Mus musculus OX=10090 GN=Sgms1 PE=1 SV=2
5	Q7TSX5	1.02e-158	453	419	0.595	0.518	SMS1_RAT Phosphatidylcholine:ceramide cholinephosphotransferase 1 OS=Rattus norvegicus OX=10116 GN=Sgms1 PE=2 SV=2
6	Q86VZ5	1.75e-157	450	413	0.589	0.521	SMS1_HUMAN Phosphatidylcholine:ceramide cholinephosphotransferase 1 OS=Homo sapiens OX=9606 GN=SGMS1 PE=1 SV=3
7	Q9DA37	6.84e-81	256	478	0.337	0.257	SAMD8_MOUSE Sphingomyelin synthase-related protein 1 OS=Mus musculus OX=10090 GN=Samd8 PE=2 SV=1
8	Q96LT4	2.00e-80	253	415	0.334	0.294	SAMD8_HUMAN Sphingomyelin synthase-related protein 1 OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=2
9	A0A5F9ZGS6	5.36e-80	254	478	0.334	0.255	A0A5F9ZGS6_HUMAN Sterile alpha motif domain containing 8 OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=1
10	Q9VS60	9.55e-70	231	600	0.310	0.188	SMSR1_DROME Ceramide phosphoethanolamine synthase OS=Drosophila melanogaster OX=7227 GN=SMSr PE=1 SV=2
11	V9HVY4	1.54e-45	160	326	0.205	0.230	V9HVY4_HUMAN Epididymis luminal protein 177 OS=Homo sapiens OX=9606 GN=HEL-177 PE=2 SV=1
12	Q5JSC9	1.12e-24	103	253	0.126	0.182	Q5JSC9_HUMAN Sterile alpha motif domain containing 8 (Fragment) OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=8
13	Q38E54	1.12e-16	82.0	323	0.184	0.207	SLS2_TRYB2 Phosphatidylethanolamine:ceramide ethanolaminephosphotransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SLS2 PE=3 SV=2
14	Q38E56	2.52e-16	81.6	365	0.175	0.175	SLS4_TRYB2 Phosphatidylcholine:ceramide cholinephosphotransferase 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SLS4 PE=3 SV=1
15	Q38E55	2.25e-15	78.2	329	0.186	0.207	SLS3_TRYB2 Phosphatidylcholine:ceramide cholinephosphotransferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=SLS3 PE=3 SV=2
16	Q56Y01	1.61e-08	57.4	289	0.118	0.149	IPCS3_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 3 OS=Arabidopsis thaliana OX=3702 GN=IPCS3 PE=2 SV=1
17	E9AFX2	2.60e-08	57.4	338	0.104	0.112	SLS_LEIMA Phosphatidylinositol:ceramide inositolphosphotransferase OS=Leishmania major OX=5664 GN=IPCS PE=3 SV=1
18	Q9M325	5.54e-06	50.1	305	0.101	0.121	IPCS1_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPCS1 PE=2 SV=1
19	Q9SH93	1.80e-05	48.1	305	0.093	0.111	IPCS2_ARATH Phosphatidylinositol:ceramide inositolphosphotransferase 2 OS=Arabidopsis thaliana OX=3702 GN=IPCS2 PE=1 SV=1
20	P0AGA2	0.92	33.9	443	0.047	0.038	SECY_ECOLI Protein translocase subunit SecY OS=Escherichia coli (strain K12) OX=83333 GN=secY PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01569 PAP2	0.56	21.4	PAP2 superfamily
2	PF14360 PAP2_C	2.8e-24	96.8	PAP2 superfamily C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015760

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015276	0.984	Sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)
2	61853.ENSNLEP00000021121	0.984	Sphingomyelin phosphodiesterase
3	61853.ENSNLEP00000006391	0.981	Sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
4	61853.ENSNLEP00000009426	0.979	Uncharacterized protein
5	61853.ENSNLEP00000014662	0.954	Uncharacterized protein
6	61853.ENSNLEP00000016258	0.952	Delta(4)-desaturase, sphingolipid 1
7	61853.ENSNLEP00000019279	0.943	Alkaline ceramidase
8	61853.ENSNLEP00000011720	0.940	Sphingosine-1-phosphate phosphatase 2
9	61853.ENSNLEP00000019953	0.940	UDP-glucose ceramide glucosyltransferase
10	61853.ENSNLEP00000001166	0.939	Delta(4)-desaturase, sphingolipid 2
11	61853.ENSNLEP00000019221	0.939	Ceramide kinase
12	61853.ENSNLEP00000001764	0.938	Ceramide synthase 4
13	61853.ENSNLEP00000012222	0.938	Ceramide synthase 2
14	61853.ENSNLEP00000019648	0.935	UDP glycosyltransferase 8
15	61853.ENSNLEP00000005561	0.934	Ceramide synthase 6
16	61853.ENSNLEP00000005046	0.933	Non-lysosomal glucosylceramidase
17	61853.ENSNLEP00000021273	0.932	Alkaline ceramidase
18	61853.ENSNLEP00000003728	0.931	N-acylsphingosine amidohydrolase (acid ceramidase) 1
19	61853.ENSNLEP00000014611	0.925	Glucosylceramidase
20	61853.ENSNLEP00000001178	0.924	Ceramide synthase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016780	1.000	phosphotransferase activity, for other substituted phosphate groups
GO:0033188	0.986	sphingomyelin synthase activity
GO:0005515	0.776	protein binding
GO:0047493	0.530	ceramide cholinephosphotransferase activity
GO:0016787	0.436	hydrolase activity
GO:0042578	0.367	phosphoric ester hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.996	cellular biosynthetic process
GO:1901566	0.993	organonitrogen compound biosynthetic process
GO:0008610	0.991	lipid biosynthetic process
GO:0006665	0.989	sphingolipid metabolic process
GO:0019637	0.981	organophosphate metabolic process
GO:0043604	0.972	amide biosynthetic process
GO:0030148	0.961	sphingolipid biosynthetic process
GO:0006644	0.957	phospholipid metabolic process
GO:0008654	0.928	phospholipid biosynthetic process
GO:0006672	0.743	ceramide metabolic process
GO:0050789	0.681	regulation of biological process
GO:0046513	0.655	ceramide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031090	0.979	organelle membrane
GO:0098588	0.859	bounding membrane of organelle
GO:0005794	0.850	Golgi apparatus
GO:0000139	0.495	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.
RHEA:18765	0.986	a 1,2-diacyl-sn-glycero-3-phosphocholine + an N-acylsphing-4-enine = a 1,2-diacyl-sn-glycerol + a sphingomyelin
EC:2.7.8.27	0.986	sphingomyelin synthase.
RHEA:16273	0.530	an N-acylsphing-4-enine + CDP-choline = a sphingomyelin + CMP + H(+)
EC:2.7.8.3	0.530	ceramide cholinephosphotransferase.
EC:3.-.-.-	0.436	Hydrolases.
EC:3.1.-.-	0.369	Acting on ester bonds.

[back to server]