StarFunc result for job id Q8NHU6

User Input

>input (1098 residues)
MLEGDLVSKMLRAVLQSHKNGVALPRLQGEYRSLTGDWIPFKQLGFPTLEAYLRSVPAVV
RIETSRSGEITCYAMACTETARIAQLVARQRSSKRKTGRQVNCQMRVKKTMPFFLEGKPK
ATLRQPGFASNFSVGKKPNPAPLRDKGNSVGVKPDAEMSPYMLHTTLGNEAFKDIPVQRH
VTMSTNNRFSPKASLQPPLQMHLSRTSTKEMSDNLNQTVEKPNVKPPASYTYKMDEVQNR
IKEILNKHNNGIWISKLPHFYKELYKEDLNQGILQQFEHWPHICTVEKPCSGGQDLLLYP
AKRKQLLRSELDTEKVPLSPLPGPKQTPPLKGCPTVMAGDFKEKVADLLVKYTSGLWASA
LPKAFEEMYKVKFPEDALKNLASLSDVCSIDYISGNPQKAILYAKLPLPTDKIQKDAGQA
HGDNDIKAMVEQEYLQVEESIAESANTFMEDITVPPLMIPTEASPSVLVVELSNTNEVVI
RYVGKDYSAAQELMEDEMKEYYSKNPKITPVQAVNVGQLLAVNAEEDAWLRAQVISTEEN
KIKVCYVDYGFSENVEKSKAYKLNPKFCSLSFQATKCKLAGLEVLSDDPDLVKVVESLTC
GKIFAVEILDKADIPLVVLYDTSGEDDININATCLKAICDKSLEVHLQVDAMYTNVKVTN
ICSDGTLYCQVPCKGLNKLSDLLRKIEDYFHCKHMTSECFVSLPFCGKICLFHCKGKWLR
VEITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQEMIAIPPQAIKCCLADLPQSI
GMWTPDAVLWLRDSVLNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNAD
LWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEE
LPPPVHLSKPGEHMDVYVPVACHPGYFVIQPWQEIHKLEVLMEEMILYYSVSEERHIAVE
KDQVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVNIRKVQPLVDMFRKLPFQAV
TAQLAGVKCNQWSEEASMVFRNHVEKKPLVALVQTVIENANPWDRKVVVYLVDTSLPDTD
TWIHDFMSEYLIELSKVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NAF9	0.378	0.384	0.000	1079	0.436	0.444	A6NAF9.pdb.gz	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
2	AFDB:E1C3S7	0.405	0.413	0.000	1071	0.484	0.496	E1C3S7.pdb.gz	TDRD7_CHICK Tudor domain-containing protein 7 OS=Gallus gallus OX=9031 GN=TDRD7 PE=2 SV=1
3	AFDB:Q8K1H1	0.501	0.507	0.000	1086	0.838	0.847	Q8K1H1.pdb.gz	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
4	AFDB:Q8NHU6	1.000	1.000	0.000	1098	1.000	1.000	Q8NHU6.pdb.gz	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
5	AFDB:Q9R1R4	0.464	0.458	0.000	1113	0.842	0.831	Q9R1R4.pdb.gz	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1
6	AFDB:Q90WE3	0.172	0.116	9.673E-27	1905	0.128	0.074	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
7	PDB:7abi7	0.053	0.219	6.380E-4	236	0.029	0.136	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
8	PDB:6tedZ	0.058	0.112	1.493E-3	510	0.032	0.069	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
9	AFDB:P47709	0.050	0.066	2.121E-3	684	0.083	0.133	P47709.pdb.gz	RP3A_RAT Rabphilin-3A OS=Rattus norvegicus OX=10116 GN=Rph3a PE=1 SV=1
10	PDB:7okyZ	0.051	0.132	2.167E-3	374	0.032	0.094	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
11	AFDB:A0A1D5PNG2	0.053	0.058	2.918E-3	890	0.084	0.103	A0A1D5PNG2.pdb.gz
12	AFDB:Q52EB3	0.040	0.042	7.597E-3	982	0.056	0.063	Q52EB3.pdb.gz	ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=ATG1 PE=1 SV=1
13	AFDB:Q08605	0.036	0.055	8.910E-3	581	0.045	0.084	Q08605.pdb.gz	GAGA_DROME Transcription factor GAGA OS=Drosophila melanogaster OX=7227 GN=Trl PE=1 SV=2
14	PDB:7kzmE	0.044	0.075	1.633E-2	474	0.035	0.080	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
15	PDB:4pa0A	0.045	0.051	3.091E-2	974	0.013	0.014	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
16	PDB:4pa0B	0.045	0.054	6.170E-2	920	0.013	0.015	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
17	PDB:3mp8A	0.049	0.098	6.507E-2	513	0.014	0.029	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
18	PDB:2ns2A	0.043	0.197	6.862E-2	201	0.019	0.104	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
19	PDB:7nkxZ	0.045	0.286	7.632E-2	156	0.015	0.103	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:1sxjH	0.056	0.159	8.048E-2	267	0.033	0.135	1sxjH.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NAF9	0.0	843	1079	0.447	0.455	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
2	E1C3S7	0.0	1006	1071	0.489	0.501	TDRD7_CHICK Tudor domain-containing protein 7 OS=Gallus gallus OX=9031 GN=TDRD7 PE=2 SV=1
3	Q8K1H1	0.0	1933	1086	0.839	0.848	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
4	Q8NHU6	0.0	2285	1098	1.000	1.000	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
5	Q9R1R4	0.0	1920	1113	0.849	0.837	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1
6	A9CPT4	3.46e-21	102	1133	0.121	0.117	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
7	Q9BXT4	1.52e-20	100	1180	0.144	0.134	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
8	Q58EK5	2.16e-15	84.0	1175	0.069	0.065	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
9	F1R237	2.76e-15	84.0	2117	0.132	0.068	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
10	Q0E910	9.40e-15	82.0	1222	0.119	0.107	Q0E910_DROME Tapas, isoform B OS=Drosophila melanogaster OX=7227 GN=tapas PE=1 SV=1
11	Q99MV1	1.35e-14	81.3	1172	0.122	0.114	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
12	Q9Y2W6	2.52e-14	79.7	561	0.057	0.112	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
13	Q80VL1	1.90e-11	70.5	560	0.053	0.104	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
14	Q99MV7	2.11e-09	64.3	1640	0.097	0.065	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
15	Q9VQ91	8.55e-09	62.0	576	0.048	0.092	TDRKH_DROME Tudor and KH domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=papi PE=1 SV=1
16	A0A140VK05	1.26e-07	58.5	903	0.046	0.055	A0A140VK05_HUMAN Testicular secretory protein Li 5 OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q92667	1.26e-07	58.5	903	0.046	0.055	AKAP1_HUMAN A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1
18	O88884	1.89e-07	57.8	854	0.041	0.053	AKAP1_RAT A-kinase anchor protein 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Akap1 PE=1 SV=1
19	H9JD76	2.63e-07	57.4	629	0.054	0.094	TDRKH_BOMMO Tudor and KH domain-containing protein homolog OS=Bombyx mori OX=7091 GN=PAPI PE=1 SV=2
20	O08715	2.71e-07	57.4	857	0.041	0.053	AKAP1_MOUSE A-kinase anchor protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Akap1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	2.5	20.0	Agenet domain
2	PF12872 OST-HTH	7.5e-17	72.3	OST-HTH/LOTUS domain
3	PF00567 TUDOR	1.4e-81	281.9	Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261211	0.942	Cyclin-dependent kinase 17
2	9606.ENSP00000321703	0.939	Transforming acidic coiled-coil-containing protein 1
3	9606.ENSP00000432768	0.912	Cytoskeleton-associated protein 5
4	9606.ENSP00000434727	0.910	Coiled-coil domain containing 180
5	9606.ENSP00000216911	0.903	Aurora kinase A
6	9606.ENSP00000387303	0.887	ATP-dependent RNA helicase TDRD9
7	9606.ENSP00000393275	0.865	Nanos homolog 1
8	9606.ENSP00000256925	0.845	CDK5 and ABL1 enzyme substrate 1
9	9606.ENSP00000349208	0.827	Piwi-like protein 2
10	9606.ENSP00000445366	0.824	Dead end protein homolog 1
11	9606.ENSP00000245255	0.816	Piwi-like protein 1
12	9606.ENSP00000341992	0.801	Nanos homolog 3
13	9606.ENSP00000250863	0.783	Deleted in azoospermia-like
14	9606.ENSP00000423665	0.776	Cyclin-dependent kinase 18
15	9606.ENSP00000220429	0.761	GA-binding protein subunit beta-1
16	9606.ENSP00000330031	0.745	Piwi-like protein 3
17	9606.ENSP00000299001	0.743	Piwi-like protein 4
18	9606.ENSP00000348132	0.741	Serine/threonine kinase 31
19	9606.ENSP00000360922	0.731	Double-stranded RNA-binding protein Staufen homolog 1
20	9606.ENSP00000276052	0.690	Cyclin-dependent kinase 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.987	RNA binding
GO:0003729	0.844	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0002089	0.968	lens morphogenesis in camera-type eye
GO:0070306	0.968	lens fiber cell differentiation
GO:0050789	0.919	regulation of biological process
GO:0060255	0.695	regulation of macromolecule metabolic process
GO:0010468	0.692	regulation of gene expression
GO:0010608	0.391	post-transcriptional regulation of gene expression
GO:0050794	0.342	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043227	0.995	membrane-bounded organelle
GO:0099080	0.993	supramolecular complex
GO:0070013	0.993	intracellular organelle lumen
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0032991	0.985	protein-containing complex
GO:0035770	0.981	ribonucleoprotein granule
GO:0036464	0.881	cytoplasmic ribonucleoprotein granule
GO:0005634	0.856	nucleus
GO:0031981	0.710	nuclear lumen
GO:0005739	0.644	mitochondrion
GO:0005654	0.514	nucleoplasm
GO:0043186	0.501	P granule
GO:1990904	0.348	ribonucleoprotein complex
GO:0033391	0.311	chromatoid body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]