StarFunc result for job id Q8NHV5

User Input

>input (167 residues)
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C784	0.999	0.999	2.868E-27	167	1.000	1.000	Q8C784.pdb.gz	MOSMO_MOUSE Modulator of smoothened protein OS=Mus musculus OX=10090 GN=Mosmo PE=2 SV=2
2	AFDB:B0UYJ1	0.833	0.642	9.524E-9	221	0.210	0.158	B0UYJ1.pdb.gz	B0UYJ1_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5 PE=4 SV=1
3	AFDB:A0A2R8QN41	0.784	0.595	2.843E-8	226	0.180	0.133	A0A2R8QN41.pdb.gz
4	AFDB:Q4KL25	0.783	0.611	2.843E-8	219	0.186	0.142	Q4KL25.pdb.gz	LHPL5_MOUSE LHFPL tetraspan subfamily member 5 protein OS=Mus musculus OX=10090 GN=Lhfpl5 PE=1 SV=1
5	AFDB:Q86UP9	0.794	0.579	2.995E-8	236	0.192	0.136	Q86UP9.pdb.gz	LHPL3_HUMAN LHFPL tetraspan subfamily member 3 protein OS=Homo sapiens OX=9606 GN=LHFPL3 PE=1 SV=3
6	AFDB:Q5U4E0	0.778	0.545	4.093E-8	247	0.144	0.097	Q5U4E0.pdb.gz	LHPL4_MOUSE LHFPL tetraspan subfamily member 4 protein OS=Mus musculus OX=10090 GN=Lhfpl4 PE=1 SV=1
7	AFDB:Q9W068	0.831	0.538	4.046E-7	265	0.186	0.117	Q9W068.pdb.gz	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1
8	AFDB:Q8N6F1	0.706	0.546	1.146E-6	224	0.204	0.152	Q8N6F1.pdb.gz	CLD19_HUMAN Claudin-19 OS=Homo sapiens OX=9606 GN=CLDN19 PE=1 SV=2
9	AFDB:Q6ZUX7	0.824	0.615	1.272E-6	228	0.174	0.127	Q6ZUX7.pdb.gz	LHPL2_HUMAN LHFPL tetraspan subfamily member 2 protein OS=Homo sapiens OX=9606 GN=LHFPL2 PE=1 SV=2
10	AFDB:Q8NHS1	0.742	0.742	1.412E-6	167	0.174	0.174	Q8NHS1.pdb.gz	CLDN2_HUMAN Claudin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CLDND2 PE=1 SV=1
11	PDB:7ocaI	0.784	0.714	7.920E-6	185	0.174	0.157	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
12	PDB:5b2gC	0.698	0.363	1.479E-5	350	0.168	0.080	5b2gC.pdb.gz
13	PDB:7rzaA	0.769	0.146	9.643E-5	981	0.150	0.025	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:7rz4A	0.598	0.123	1.070E-4	993	0.174	0.029	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:6ov2A	0.720	0.667	1.388E-4	182	0.156	0.143	6ov2A.pdb.gz
16	PDB:5weoA	0.741	0.142	1.463E-4	988	0.162	0.027	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
17	PDB:6c14B	0.713	0.725	2.106E-4	164	0.162	0.165	6c14B.pdb.gz
18	PDB:5kbtA	0.595	0.132	2.732E-4	973	0.204	0.035	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
19	PDB:6jp5E	0.635	0.629	3.545E-4	169	0.150	0.148	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
20	PDB:5kk2E	0.593	0.577	4.790E-3	173	0.126	0.121	5kk2E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C784	1.02e-120	339	167	1.000	1.000	MOSMO_MOUSE Modulator of smoothened protein OS=Mus musculus OX=10090 GN=Mosmo PE=2 SV=2
2	Q8MRC9	2.4	30.8	650	0.066	0.017	GALT9_DROME Putative polypeptide N-acetylgalactosaminyltransferase 9 OS=Drosophila melanogaster OX=7227 GN=Pgant9 PE=1 SV=2
3	Q57WC3	5.1	30.0	1232	0.102	0.014	Q57WC3_TRYB2 Lipase domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.580 PE=4 SV=1
4	Q9XIG2	5.3	29.6	421	0.096	0.038	PLM_ARATH Protein PHLOEM UNLOADING MODULATOR OS=Arabidopsis thaliana OX=3702 GN=PLM PE=2 SV=1
5	Q9BXB1	6.3	29.6	951	0.090	0.016	LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens OX=9606 GN=LGR4 PE=1 SV=2
6	Q9W068	8.3	28.9	265	0.072	0.045	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18800 Atthog	3e-64	226.6	Attenuator of Hedgehog
2	PF01654 Cyt_bd_oxida_I	0.28	21.4	Cytochrome bd terminal oxidase subunit I
3	PF19529 DUF6057	5.8e+02	10.7	Family of unknown function (DUF6057)
4	PF10242 L_HMGIC_fpl	0.04	25.7	Lipoma HMGIC fusion partner-like protein
5	PF07331 TctB	2e+02	13.7	Tripartite tricarboxylate transporter TctB family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 303518.XP_005734727.1

Rank	PPI partner	STRING score	Description
1	303518.XP_005720335.1	0.660	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
2	303518.XP_005742933.1	0.636	Mesoderm development candidate 1-like
3	303518.XP_005726041.1	0.584	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 10 samples with support for all annotated introns
4	303518.XP_005720623.1	0.564	Tubulin delta chain-like isoform X1
5	303518.XP_005747593.1	0.542	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
6	303518.XP_005734381.1	0.535	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
7	303518.XP_005739463.1	0.535	Ras-related protein Rab-34-like isoform X1
8	303518.XP_005736266.1	0.524	Multiple epidermal growth factor-like domains protein 8-like
9	303518.XP_005755461.1	0.524	Multiple epidermal growth factor-like domains protein 8-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0008589	0.984	regulation of smoothened signaling pathway
GO:0048523	0.974	negative regulation of cellular process
GO:0045595	0.963	regulation of cell differentiation
GO:0065008	0.958	regulation of biological quality
GO:0045879	0.950	negative regulation of smoothened signaling pathway
GO:0045664	0.911	regulation of neuron differentiation
GO:0031647	0.910	regulation of protein stability
GO:0009987	0.528	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0098590	0.998	plasma membrane region
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0005929	0.990	cilium
GO:0098588	0.988	bounding membrane of organelle
GO:0031253	0.988	cell projection membrane
GO:0005794	0.988	Golgi apparatus
GO:0060170	0.981	ciliary membrane
GO:0031982	0.328	vesicle
GO:0005634	0.328	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]