StarFunc result for job id Q8NHV9

User Input

>input (184 residues)
MARSLVHDTVFYCLSVYQVKISPTPQLGAASSAEGHVGQGAPGLMGNMNPEGGVNHENGM
NRDGGMIPEGGGGNQEPRQQPQPPPEEPAQAAMEGPQPENMQPRTRRTKFTLLQVEELES
VFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCVY
IVVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHV9	0.999	0.999	2.737E-26	184	1.000	1.000	Q8NHV9.pdb.gz	RHXF1_HUMAN Rhox homeobox family member 1 OS=Homo sapiens OX=9606 GN=RHOXF1 PE=1 SV=1
2	AFDB:Q8N693	0.390	0.184	4.691E-8	406	0.375	0.170	Q8N693.pdb.gz	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
3	AFDB:P54821	0.339	0.265	7.772E-7	245	0.261	0.196	P54821.pdb.gz	PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens OX=9606 GN=PRRX1 PE=1 SV=2
4	AFDB:Q03356	0.364	0.264	1.471E-6	257	0.223	0.160	Q03356.pdb.gz	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
5	AFDB:Q9Z2U3	0.392	0.210	1.671E-6	387	0.321	0.152	Q9Z2U3.pdb.gz	Q9Z2U3_MOUSE Homeodomain protein EPX (Fragment) OS=Mus musculus OX=10090 GN=Esx1 PE=2 SV=1
6	AFDB:Q1LVQ7	0.351	0.206	2.157E-6	320	0.228	0.131	Q1LVQ7.pdb.gz	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
7	AFDB:F6YCR7	0.373	0.300	2.784E-6	232	0.332	0.263	F6YCR7.pdb.gz	RHX13_MOUSE Homeobox protein Rhox13 OS=Mus musculus OX=10090 GN=Rhox13 PE=1 SV=2
8	AFDB:Q6P295	0.378	0.287	2.784E-6	245	0.228	0.171	Q6P295.pdb.gz	Q6P295_DANRE Paired mesoderm homeobox protein 1 OS=Danio rerio OX=7955 GN=fa97b09 PE=2 SV=1
9	AFDB:Q15699	0.341	0.201	3.594E-6	326	0.261	0.147	Q15699.pdb.gz	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
10	AFDB:O18400	0.332	0.128	4.083E-6	509	0.245	0.088	O18400.pdb.gz	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
11	PDB:4egcA	0.269	0.092	5.410E-3	539	0.103	0.035	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.258	0.583	1.819E-2	73	0.120	0.301	2hi3A.pdb.gz
13	PDB:4p9uE	0.155	0.112	1.583	272	0.076	0.051	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
14	PDB:3ndbB	0.224	0.107	1.799	420	0.065	0.029	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
15	PDB:1tq6A	0.127	0.062	1.917	402	0.049	0.022	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
16	PDB:7dcoL	0.200	0.094	2.178	435	0.098	0.041	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
17	PDB:7awtE	0.171	0.199	2.638	156	0.038	0.045	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
18	PDB:1yioA	0.179	0.169	2.811	198	0.049	0.045	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
19	PDB:4ldzA	0.207	0.197	2.997	196	0.038	0.036	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
20	PDB:7fbyA	0.179	0.209	2.997	153	0.038	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHV9	5.65e-137	381	184	1.000	1.000	RHXF1_HUMAN Rhox homeobox family member 1 OS=Homo sapiens OX=9606 GN=RHOXF1 PE=1 SV=1
2	Q8N693	2.85e-24	99.8	406	0.364	0.165	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
3	P0C7M4	4.45e-16	76.3	288	0.272	0.174	RHF2B_HUMAN Rhox homeobox family member 2B OS=Homo sapiens OX=9606 GN=RHOXF2B PE=1 SV=1
4	Q9BQY4	1.52e-15	74.7	288	0.245	0.156	RHXF2_HUMAN Rhox homeobox family member 2 OS=Homo sapiens OX=9606 GN=RHOXF2 PE=1 SV=1
5	Q06453	3.93e-15	74.3	408	0.168	0.076	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
6	Q7SZN8	4.40e-15	73.6	299	0.196	0.120	Q7SZN8_DANRE Short stature homeobox 2 OS=Danio rerio OX=7955 GN=zgc:65884 PE=2 SV=1
7	O60902	4.87e-15	73.6	331	0.179	0.100	SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens OX=9606 GN=SHOX2 PE=1 SV=4
8	P70390	5.16e-15	73.6	331	0.179	0.100	SHOX2_MOUSE Short stature homeobox protein 2 OS=Mus musculus OX=10090 GN=Shox2 PE=2 SV=1
9	Q8BYH0	5.43e-15	72.8	263	0.179	0.125	DRGX_MOUSE Dorsal root ganglia homeobox protein OS=Mus musculus OX=10090 GN=Drgx PE=1 SV=2
10	A6NNA5	5.48e-15	72.8	263	0.179	0.125	DRGX_HUMAN Dorsal root ganglia homeobox protein OS=Homo sapiens OX=9606 GN=DRGX PE=3 SV=1
11	P09083	6.74e-15	73.9	449	0.179	0.073	GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster OX=7227 GN=gsb-n PE=1 SV=2
12	B0S5T0	7.41e-15	72.8	285	0.163	0.105	B0S5T0_DANRE Short stature homeobox OS=Danio rerio OX=7955 GN=si:ch211-134k13.1 PE=4 SV=1
13	O15266	8.68e-15	72.8	292	0.163	0.103	SHOX_HUMAN Short stature homeobox protein OS=Homo sapiens OX=9606 GN=SHOX PE=1 SV=1
14	O35160	1.43e-14	72.0	302	0.196	0.119	PITX3_MOUSE Pituitary homeobox 3 OS=Mus musculus OX=10090 GN=Pitx3 PE=1 SV=1
15	P81062	1.52e-14	72.0	302	0.196	0.119	PITX3_RAT Pituitary homeobox 3 OS=Rattus norvegicus OX=10116 GN=Pitx3 PE=1 SV=2
16	O75364	1.89e-14	71.6	302	0.223	0.136	PITX3_HUMAN Pituitary homeobox 3 OS=Homo sapiens OX=9606 GN=PITX3 PE=1 SV=1
17	F1Q9S0	2.23e-14	72.4	469	0.212	0.083	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
18	Q9XSK0	3.01e-14	71.2	299	0.190	0.117	CRX_BOVIN Cone-rod homeobox protein OS=Bos taurus OX=9913 GN=CRX PE=1 SV=1
19	Q21836	3.10e-14	71.6	362	0.168	0.086	ARXH_CAEEL Homeobox ARX homolog alr-1 OS=Caenorhabditis elegans OX=6239 GN=alr-1 PE=1 SV=1
20	Q5I7G4	3.26e-14	70.9	284	0.174	0.113	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	13	17.1	Homeobox KN domain
2	PF00046 Homeodomain	4.8e-16	69.7	Homeodomain
3	PF04539 Sigma70_r3	1.2e+02	14.2	Sigma-70 region 3
4	PF15943 YdaS_antitoxin	42	15.6	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217999

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220822	0.705	Ganglioside-induced differentiation-associated protein 1
2	9606.ENSP00000453704	0.665	Homeobox protein TGIF2LX
3	9606.ENSP00000406022	0.563	Netrin receptor UNC5C
4	9606.ENSP00000358931	0.528	Transketolase-like protein 1
5	9606.ENSP00000363822	0.506	Androgen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0003700	0.981	DNA-binding transcription factor activity
GO:0000981	0.949	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.939	transcription cis-regulatory region binding
GO:0000977	0.849	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.416	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0009987	0.974	cellular process
GO:0010468	0.927	regulation of gene expression
GO:0048518	0.801	positive regulation of biological process
GO:0050896	0.773	response to stimulus
GO:0030522	0.695	intracellular receptor signaling pathway
GO:0042221	0.674	response to chemical
GO:0071383	0.572	cellular response to steroid hormone stimulus
GO:0030518	0.558	intracellular steroid hormone receptor signaling pathway
GO:0080090	0.460	regulation of primary metabolic process
GO:0051171	0.460	regulation of nitrogen compound metabolic process
GO:0031323	0.460	regulation of cellular metabolic process
GO:0010604	0.447	positive regulation of macromolecule metabolic process
GO:0032502	0.431	developmental process
GO:0010556	0.325	regulation of macromolecule biosynthetic process
GO:0031326	0.325	regulation of cellular biosynthetic process
GO:0051252	0.325	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.996	cytoplasm
GO:0005654	0.992	nucleoplasm
GO:0005829	0.970	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]