StarFunc result for job id Q8NHW4

User Input

>input (92 residues)
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQ
PAVVFQTKRGKQVCADPSESWVQEYVYDLELN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13236	0.856	0.856	7.382E-16	92	0.967	0.967	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
2	AFDB:P50230	0.813	0.813	1.767E-14	92	0.783	0.783	P50230.pdb.gz	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
3	AFDB:P14097	0.724	0.724	7.844E-14	92	0.761	0.761	P14097.pdb.gz	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
4	AFDB:P16619	0.690	0.683	5.137E-13	93	0.598	0.591	P16619.pdb.gz	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
5	AFDB:P10855	0.689	0.689	3.589E-12	92	0.609	0.609	P10855.pdb.gz	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
6	AFDB:P50229	0.694	0.694	1.935E-11	92	0.554	0.554	P50229.pdb.gz	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
7	PDB:1humA	0.657	0.858	1.176E-10	69	0.739	0.986	1humA.pdb.gz
8	AFDB:P13501	0.675	0.682	3.350E-10	91	0.424	0.429	P13501.pdb.gz	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
9	PDB:4zltF	0.635	0.927	4.893E-10	62	0.478	0.710	4zltF.pdb.gz
10	AFDB:P14844	0.682	0.431	6.003E-10	148	0.413	0.257	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
11	AFDB:P50231	0.759	0.759	9.449E-10	92	0.446	0.446	P50231.pdb.gz	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
12	AFDB:P55774	0.659	0.681	1.148E-9	89	0.446	0.461	P55774.pdb.gz	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
13	PDB:7f1qR	0.640	0.169	1.422E-8	367	0.478	0.120	7f1qR.pdb.gz
14	PDB:7f1tA	0.641	0.143	2.098E-8	423	0.467	0.102	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
15	PDB:2q8tB	0.661	0.928	3.303E-8	65	0.370	0.523	2q8tB.pdb.gz
16	PDB:5yamA	0.634	0.819	5.199E-8	69	0.402	0.536	5yamA.pdb.gz
17	PDB:1esrA	0.664	0.795	1.131E-7	76	0.293	0.355	1esrA.pdb.gz
18	PDB:4mheA	0.610	0.801	2.308E-7	69	0.348	0.464	4mheA.pdb.gz
19	PDB:2ra4B	0.630	0.878	2.803E-7	65	0.293	0.415	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
20	PDB:6fgpB	0.594	0.777	8.999E-7	68	0.370	0.500	6fgpB.pdb.gz	The solution structure of monomeric CCL5 in complex with a doubly sulfated N-terminal segment of CCR5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHW4	1.45e-63	188	92	1.000	1.000	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
2	P13236	6.04e-61	182	92	0.967	0.967	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
3	P50230	1.26e-50	155	92	0.783	0.783	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
4	P14097	1.05e-41	133	92	0.761	0.761	CCL4_MOUSE C-C motif chemokine 4 OS=Mus musculus OX=10090 GN=Ccl4 PE=3 SV=3
5	P16619	1.68e-39	128	93	0.598	0.591	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
6	P10855	7.89e-39	126	92	0.609	0.609	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2
7	P50229	2.44e-36	120	92	0.576	0.576	CCL3_RAT C-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Ccl3 PE=1 SV=1
8	P10147	3.96e-35	117	92	0.565	0.565	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
9	Q9I8E0	7.15e-27	95.9	89	0.489	0.506	Q9I8E0_CHICK Chemokine C-C motif ligand 4 OS=Gallus gallus OX=9031 GN=K203 PE=2 SV=1
10	Q4KS30	2.05e-26	94.7	89	0.489	0.506	Q4KS30_CHICK Chemokine K203 OS=Gallus gallus OX=9031 PE=4 SV=1
11	Q16627	2.61e-26	94.7	93	0.446	0.441	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
12	P30882	6.95e-25	90.9	91	0.478	0.484	CCL5_MOUSE C-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Ccl5 PE=1 SV=2
13	P55774	3.81e-23	86.7	89	0.457	0.472	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
14	P50231	1.08e-22	85.5	92	0.446	0.446	CCL5_RAT C-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Ccl5 PE=3 SV=1
15	P13501	1.21e-22	85.5	91	0.446	0.451	CCL5_HUMAN C-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CCL5 PE=1 SV=3
16	Q99616	2.33e-21	82.4	98	0.402	0.378	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
17	P14844	4.11e-19	78.2	148	0.424	0.264	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
18	P10148	2.29e-17	73.6	148	0.402	0.250	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
19	Q9Y258	2.39e-17	72.0	94	0.359	0.351	CCL26_HUMAN C-C motif chemokine 26 OS=Homo sapiens OX=9606 GN=CCL26 PE=1 SV=1
20	P48298	1.46e-16	70.1	97	0.391	0.371	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	2.3e-17	74.2	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292303	0.999	C-C chemokine receptor type 5
2	9606.ENSP00000292301	0.934	C-C chemokine receptor type 2
3	9606.ENSP00000296140	0.930	C-C chemokine receptor type 1
4	9606.ENSP00000263341	0.910	Interleukin-1 beta
5	9606.ENSP00000305651	0.889	C-X-C motif chemokine 10
6	9606.ENSP00000306512	0.880	Interleukin-8
7	9606.ENSP00000398698	0.860	Tumor necrosis factor
8	9606.ENSP00000385675	0.849	Interleukin-6
9	9606.ENSP00000386884	0.840	C-X-C chemokine receptor type 4
10	9606.ENSP00000225474	0.839	Granulocyte colony-stimulating factor
11	9606.ENSP00000296871	0.838	Granulocyte-macrophage colony-stimulating factor
12	9606.ENSP00000412237	0.836	Interleukin-10
13	9606.ENSP00000349770	0.833	Interferon regulatory factor 5
14	9606.ENSP00000441600	0.832	C-C chemokine receptor type 3
15	9606.ENSP00000226730	0.825	Interleukin-2
16	9606.ENSP00000231454	0.823	Interleukin-5
17	9606.ENSP00000304915	0.823	Interleukin-13
18	9606.ENSP00000344192	0.822	Interleukin-17A
19	9606.ENSP00000263339	0.811	Interleukin-1 alpha
20	9606.ENSP00000362795	0.808	C-X-C chemokine receptor type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.751	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0042221	0.988	response to chemical
GO:0048518	0.987	positive regulation of biological process
GO:0042330	0.979	taxis
GO:0006950	0.977	response to stress
GO:0006935	0.962	chemotaxis
GO:0006952	0.955	defense response
GO:0006954	0.947	inflammatory response
GO:0002376	0.934	immune system process
GO:0048522	0.916	positive regulation of cellular process
GO:0070887	0.915	cellular response to chemical stimulus
GO:0048584	0.883	positive regulation of response to stimulus
GO:0023052	0.872	signaling
GO:0007154	0.867	cell communication
GO:0019222	0.846	regulation of metabolic process
GO:0007165	0.833	signal transduction
GO:0060255	0.832	regulation of macromolecule metabolic process
GO:0048870	0.827	cell motility
GO:0051239	0.780	regulation of multicellular organismal process
GO:0044419	0.728	biological process involved in interspecies interaction between organisms
GO:0009893	0.669	positive regulation of metabolic process
GO:0010604	0.657	positive regulation of macromolecule metabolic process
GO:0016477	0.653	cell migration
GO:0032501	0.649	multicellular organismal process
GO:0051240	0.628	positive regulation of multicellular organismal process
GO:0002684	0.625	positive regulation of immune system process
GO:0010468	0.594	regulation of gene expression
GO:0032101	0.593	regulation of response to external stimulus
GO:0050900	0.586	leukocyte migration
GO:0040012	0.574	regulation of locomotion
GO:0006955	0.572	immune response
GO:0040017	0.549	positive regulation of locomotion
GO:0001817	0.546	regulation of cytokine production
GO:0030334	0.537	regulation of cell migration
GO:0009966	0.508	regulation of signal transduction
GO:0048519	0.502	negative regulation of biological process
GO:0048523	0.468	negative regulation of cellular process
GO:0010628	0.468	positive regulation of gene expression
GO:0010033	0.428	response to organic substance
GO:0051707	0.427	response to other organism
GO:0001819	0.427	positive regulation of cytokine production
GO:0042127	0.426	regulation of cell population proliferation
GO:0002685	0.420	regulation of leukocyte migration
GO:0060326	0.413	cell chemotaxis
GO:0034097	0.397	response to cytokine
GO:2000147	0.389	positive regulation of cell motility
GO:0071310	0.384	cellular response to organic substance
GO:0032103	0.383	positive regulation of response to external stimulus
GO:0032502	0.382	developmental process
GO:0009410	0.382	response to xenobiotic stimulus
GO:0030335	0.378	positive regulation of cell migration
GO:0030595	0.348	leukocyte chemotaxis
GO:0031323	0.328	regulation of cellular metabolic process
GO:0050793	0.327	regulation of developmental process
GO:0032879	0.326	regulation of localization
GO:0009967	0.315	positive regulation of signal transduction
GO:0065008	0.306	regulation of biological quality
GO:0080134	0.302	regulation of response to stress
GO:0051171	0.302	regulation of nitrogen compound metabolic process
GO:0080090	0.301	regulation of primary metabolic process
GO:0071345	0.301	cellular response to cytokine stimulus
GO:0048856	0.300	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.519	intracellular anatomical structure
GO:0071944	0.503	cell periphery
GO:0005737	0.503	cytoplasm
GO:0005886	0.461	plasma membrane
GO:0043226	0.305	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]