StarFunc result for job id Q8NHX9

User Input

>input (752 residues)
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSL
WDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHX9	1.000	1.000	7.763E-96	752	1.000	1.000	Q8NHX9.pdb.gz	TPC2_HUMAN Two pore channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2
2	AFDB:D3ZTJ6	0.902	0.954	3.817E-73	711	0.705	0.745	D3ZTJ6.pdb.gz	D3ZTJ6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=1
3	PDB:6nq0A	0.805	0.972	9.948E-64	621	0.820	0.994	6nq0A.pdb.gz	Structural mechanisms of phospholipid activation of the human TPC2 channel.
4	AFDB:A0JMD4	0.908	0.883	1.422E-63	774	0.568	0.552	A0JMD4.pdb.gz	TPC2_DANRE Two pore channel protein 2 OS=Danio rerio OX=7955 GN=tpcn2 PE=2 SV=1
5	AFDB:F1MAS6	0.648	0.923	2.130E-47	525	0.513	0.735	F1MAS6.pdb.gz	F1MAS6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=3
6	AFDB:C4IXV6	0.789	0.769	3.567E-29	773	0.239	0.233	C4IXV6.pdb.gz	C4IXV6_DANRE Two pore channel 3 OS=Danio rerio OX=7955 GN=TPC3 PE=1 SV=1
7	AFDB:Q9EQJ0	0.713	0.660	3.546E-24	817	0.238	0.219	Q9EQJ0.pdb.gz	TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus OX=10090 GN=Tpcn1 PE=1 SV=1
8	AFDB:Q94KI8	0.712	0.729	1.663E-23	733	0.211	0.217	Q94KI8.pdb.gz	TPC1_ARATH Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1
9	PDB:6c9aB	0.716	0.743	2.889E-22	723	0.223	0.232	6c9aB.pdb.gz	Structural insights into the voltage and phospholipid activation of the mammalian TPC1 channel.
10	PDB:7fhkA	0.634	0.709	2.596E-21	663	0.201	0.228	7fhkA.pdb.gz	Voltage-gating and cytosolic Ca 2+ activation mechanisms of Arabidopsis two-pore channel AtTPC1.
11	PDB:7tddB	0.613	0.747	2.903E-19	606	0.191	0.238	7tddB.pdb.gz
12	PDB:7tdfA	0.605	0.748	7.100E-19	594	0.195	0.247	7tdfA.pdb.gz
13	PDB:6v1qA	0.616	0.846	1.693E-17	538	0.205	0.286	6v1qA.pdb.gz	Resting state structure of the hyperdepolarization activated two-pore channel 3.
14	PDB:6e1pA	0.607	0.694	4.037E-16	646	0.193	0.224	6e1pA.pdb.gz	Structural basis for activation of voltage sensor domains in an ion channel TPC1.
15	AFDB:O95180	0.520	0.192	3.416E-13	2353	0.172	0.055	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
16	AFDB:Q61290	0.487	0.184	6.036E-13	2272	0.185	0.061	Q61290.pdb.gz	CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus OX=10090 GN=Cacna1e PE=1 SV=1
17	AFDB:F1R736	0.484	0.222	8.704E-13	1859	0.181	0.073	F1R736.pdb.gz
18	PDB:7tdeB	0.498	0.776	3.499E-12	470	0.161	0.257	7tdeB.pdb.gz
19	PDB:6e1kA	0.500	0.682	1.286E-11	536	0.165	0.231	6e1kA.pdb.gz	Structural basis for activation of voltage sensor domains in an ion channel TPC1.
20	PDB:7mixA	0.498	0.302	1.641E-11	1326	0.152	0.086	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMD4	0.0	838	774	0.576	0.559	TPC2_DANRE Two pore channel protein 2 OS=Danio rerio OX=7955 GN=tpcn2 PE=2 SV=1
2	B2RYH7	0.0	753	525	0.511	0.731	B2RYH7_RAT Tpcn2 protein OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=2 SV=1
3	D3ZTJ6	0.0	1039	711	0.715	0.757	D3ZTJ6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=1
4	F1MAS6	0.0	1090	733	0.738	0.757	F1MAS6_RAT Two pore segment channel 2 OS=Rattus norvegicus OX=10116 GN=Tpcn2 PE=4 SV=3
5	Q8BWC0	0.0	1089	731	0.729	0.750	TPC2_MOUSE Two pore channel protein 2 OS=Mus musculus OX=10090 GN=Tpcn2 PE=1 SV=1
6	Q8NHX9	0.0	1533	752	1.000	1.000	TPC2_HUMAN Two pore channel protein 2 OS=Homo sapiens OX=9606 GN=TPCN2 PE=1 SV=2
7	C4IXV6	9.57e-47	180	773	0.234	0.228	C4IXV6_DANRE Two pore channel 3 OS=Danio rerio OX=7955 GN=TPC3 PE=1 SV=1
8	Q94KI8	1.08e-41	165	733	0.247	0.254	TPC1_ARATH Two pore calcium channel protein 1 OS=Arabidopsis thaliana OX=3702 GN=TPC1 PE=1 SV=1
9	Q9EQJ0	2.99e-37	152	817	0.213	0.196	TPC1_MOUSE Two pore calcium channel protein 1 OS=Mus musculus OX=10090 GN=Tpcn1 PE=1 SV=1
10	Q9ULQ1	3.82e-36	148	816	0.210	0.194	TPC1_HUMAN Two pore channel protein 1 OS=Homo sapiens OX=9606 GN=TPCN1 PE=1 SV=3
11	O95180	3.19e-15	82.8	2353	0.089	0.028	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
12	Q9EQ60	3.63e-15	82.4	2359	0.090	0.029	CAC1H_RAT Voltage-dependent T-type calcium channel subunit alpha-1H OS=Rattus norvegicus OX=10116 GN=Cacna1h PE=2 SV=2
13	Q9R053	3.64e-15	82.4	1765	0.173	0.074	SCNBA_MOUSE Sodium channel protein type 11 subunit alpha OS=Mus musculus OX=10090 GN=Scn11a PE=1 SV=2
14	G5EBS2	4.99e-15	82.0	1837	0.097	0.040	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
15	O88427	5.37e-15	82.0	2365	0.089	0.028	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
16	Q7Z002	6.08e-15	81.6	1852	0.097	0.039	Q7Z002_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
17	Q24270	7.83e-15	81.6	2516	0.181	0.054	CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2
18	Q7YZR6	8.92e-15	81.3	1844	0.098	0.040	Q7YZR6_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
19	O54898	1.48e-13	77.4	2254	0.094	0.031	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
20	Q5SUF8	1.58e-13	77.4	2254	0.094	0.031	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	5.4e-52	188.0	Ion transport protein
2	PF01997 Translin	2.9e+02	12.8	Translin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294309

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448083	0.906	Two pore calcium channel protein 1
2	9606.ENSP00000226279	0.856	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
3	9606.ENSP00000264079	0.843	Mucolipin-1
4	9606.ENSP00000431840	0.829	Sodium/potassium/calcium exchanger 4
5	9606.ENSP00000359621	0.773	Mucolipin-3
6	9606.ENSP00000341550	0.763	Sodium/potassium/calcium exchanger 5
7	9606.ENSP00000296589	0.691	Membrane-associated transporter protein
8	9606.ENSP00000346659	0.680	P protein
9	9606.ENSP00000478059	0.680	Stromal interaction molecule 1
10	9606.ENSP00000359640	0.657	Mucolipin-2
11	9606.ENSP00000480616	0.653	Calcium release-activated calcium channel protein 1
12	9606.ENSP00000356579	0.609	Centrosome-associated protein 350
13	9606.ENSP00000454804	0.606	Agouti-signaling protein
14	9606.ENSP00000353575	0.601	Translation initiation factor eIF-2B subunit gamma
15	9606.ENSP00000263321	0.594	Tyrosinase
16	9606.ENSP00000298910	0.574	Leucine-rich repeat serine/threonine-protein kinase 2
17	9606.ENSP00000265062	0.567	Ras-related protein Rab-7a
18	9606.ENSP00000333298	0.567	Lysosome-associated membrane glycoprotein 1
19	9606.ENSP00000306253	0.563	Inositol 1,4,5-trisphosphate receptor type 1
20	9606.ENSP00000370343	0.562	Interferon regulatory factor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0015280	1.000	ligand-gated sodium channel activity
GO:0015278	1.000	calcium-release channel activity
GO:0043167	0.996	ion binding
GO:0043168	0.988	anion binding
GO:0035091	0.977	phosphatidylinositol binding
GO:0080025	0.974	phosphatidylinositol-3,5-bisphosphate binding
GO:0019899	0.854	enzyme binding
GO:0019901	0.835	protein kinase binding
GO:0097682	0.421	intracellular phosphatidylinositol-3,5-bisphosphate-sensitive monatomic cation channel activity
GO:0022832	0.396	voltage-gated channel activity
GO:0022843	0.374	voltage-gated monoatomic cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.985	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0050896	0.971	response to stimulus
GO:0006810	0.965	transport
GO:0098660	0.949	inorganic ion transmembrane transport
GO:0034220	0.948	monoatomic ion transmembrane transport
GO:0007154	0.934	cell communication
GO:0030001	0.885	metal ion transport
GO:0098662	0.847	inorganic cation transmembrane transport
GO:0019725	0.845	cellular homeostasis
GO:0051716	0.842	cellular response to stimulus
GO:0023052	0.839	signaling
GO:0098655	0.740	monoatomic cation transmembrane transport
GO:0071840	0.709	cellular component organization or biogenesis
GO:0016192	0.708	vesicle-mediated transport
GO:0019058	0.594	viral life cycle
GO:0044000	0.569	movement in host
GO:0016043	0.564	cellular component organization
GO:0046718	0.551	viral entry into host cell
GO:0046794	0.528	transport of virus
GO:0007165	0.491	signal transduction
GO:0030003	0.453	intracellular monoatomic cation homeostasis
GO:0120305	0.428	regulation of pigmentation
GO:0019222	0.421	regulation of metabolic process
GO:0006897	0.367	endocytosis
GO:0006996	0.353	organelle organization
GO:0031323	0.314	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0005765	0.999	lysosomal membrane
GO:0012505	0.997	endomembrane system
GO:0005768	0.989	endosome
GO:0010008	0.969	endosome membrane
GO:0071944	0.881	cell periphery
GO:0005886	0.870	plasma membrane
GO:0042470	0.801	melanosome
GO:0045009	0.787	chitosome
GO:0090741	0.787	pigment granule membrane
GO:0036019	0.782	endolysosome
GO:0036020	0.411	endolysosome membrane
GO:0033162	0.394	melanosome membrane
GO:0043233	0.376	organelle lumen
GO:0070013	0.365	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]