StarFunc result for job id Q8NHY2

User Input

>input (731 residues)
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGG
LGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNL
MLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMS
GLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRL
TAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSS
YHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKL
WSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRK
AVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSE
NNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAAN
SQGTIKVLELV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096UWG1	0.541	0.539	0.000	733	0.978	0.975	A0A096UWG1.pdb.gz	A0A096UWG1_RAT COP1, E3 ubiquitin ligase OS=Rattus norvegicus OX=10116 GN=Cop1 PE=1 SV=2
2	AFDB:Q9R1A8	0.661	0.659	0.000	733	0.978	0.975	Q9R1A8.pdb.gz	COP1_MOUSE E3 ubiquitin-protein ligase COP1 OS=Mus musculus OX=10090 GN=Cop1 PE=1 SV=2
3	AFDB:P43254	0.563	0.606	2.491E-63	675	0.346	0.375	P43254.pdb.gz	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
4	AFDB:Q94BM7	0.505	0.467	5.284E-51	794	0.263	0.242	Q94BM7.pdb.gz	SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=SPA4 PE=1 SV=1
5	PDB:7vggA	0.408	0.973	9.735E-41	304	0.219	0.526	7vggA.pdb.gz
6	AFDB:Q9FFA7	0.414	0.808	5.574E-33	368	0.144	0.285	Q9FFA7.pdb.gz	RUP2_ARATH WD repeat-containing protein RUP2 OS=Arabidopsis thaliana OX=3702 GN=RUP2 PE=1 SV=1
7	PDB:8gqeA	0.410	0.843	1.338E-32	348	0.144	0.302	8gqeA.pdb.gz
8	AFDB:Q57W14	0.359	0.598	4.522E-23	419	0.088	0.153	Q57W14.pdb.gz	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
9	PDB:2h9lA	0.379	0.839	5.918E-23	321	0.109	0.249	2h9lA.pdb.gz
10	PDB:3dm0A	0.378	0.409	2.803E-21	675	0.097	0.105	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
11	AFDB:Q9UUG8	0.373	0.452	2.821E-21	598	0.145	0.177	Q9UUG8.pdb.gz	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
12	PDB:5mzhB	0.359	0.601	4.356E-21	415	0.096	0.169	5mzhB.pdb.gz
13	AFDB:Q3Y8L7	0.362	0.566	8.976E-21	446	0.092	0.150	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
14	AFDB:Q8N136	0.356	0.594	9.485E-21	415	0.081	0.142	Q8N136.pdb.gz	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
15	PDB:3jcmB	0.398	0.661	1.929E-20	429	0.077	0.131	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
16	PDB:5yzgs	0.371	0.706	2.154E-20	374	0.086	0.168	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
17	AFDB:E9QFM9	0.374	0.464	3.560E-20	583	0.098	0.123	E9QFM9.pdb.gz
18	PDB:3jb9L	0.365	0.886	5.809E-20	293	0.089	0.222	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:6bk8D	0.377	0.743	6.853E-20	359	0.089	0.181	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:5o9zL	0.367	0.576	1.655E-19	459	0.093	0.148	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096UWG1	0.0	1095	684	0.848	0.906	A0A096UWG1_RAT COP1, E3 ubiquitin ligase OS=Rattus norvegicus OX=10116 GN=Cop1 PE=1 SV=2
2	Q5BJY0	0.0	896	433	0.588	0.993	Q5BJY0_RAT Ring finger and WD repeat domain 2 OS=Rattus norvegicus OX=10116 GN=Cop1 PE=2 SV=1
3	Q8NHY2	0.0	1517	731	1.000	1.000	COP1_HUMAN E3 ubiquitin-protein ligase COP1 OS=Homo sapiens OX=9606 GN=COP1 PE=1 SV=1
4	Q9R1A8	0.0	1474	733	0.978	0.975	COP1_MOUSE E3 ubiquitin-protein ligase COP1 OS=Mus musculus OX=10090 GN=Cop1 PE=1 SV=2
5	P43254	8.32e-153	461	675	0.363	0.393	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
6	Q9SYX2	4.60e-103	341	1029	0.269	0.191	SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana OX=3702 GN=SPA1 PE=1 SV=1
7	Q94BM7	7.11e-103	335	794	0.268	0.247	SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=SPA4 PE=1 SV=1
8	Q9T014	3.61e-101	336	1036	0.261	0.184	SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=SPA2 PE=1 SV=2
9	Q9LJR3	3.99e-98	323	845	0.269	0.233	SPA3_ARATH Protein SPA1-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=SPA3 PE=1 SV=1
10	Q9FFA7	2.64e-47	174	368	0.145	0.288	RUP2_ARATH WD repeat-containing protein RUP2 OS=Arabidopsis thaliana OX=3702 GN=RUP2 PE=1 SV=1
11	Q9LTJ6	7.34e-43	162	385	0.138	0.262	RUP1_ARATH WD repeat-containing protein RUP1 OS=Arabidopsis thaliana OX=3702 GN=RUP1 PE=1 SV=1
12	Q7ZTX2	2.44e-17	86.3	334	0.103	0.225	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
13	Q9V3J8	2.48e-17	86.7	361	0.100	0.202	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
14	Q54KL5	3.51e-17	85.9	335	0.097	0.212	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
15	P61964	5.25e-17	85.1	334	0.101	0.222	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
16	P61965	5.25e-17	85.1	334	0.101	0.222	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
17	Q498M4	5.25e-17	85.1	334	0.101	0.222	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
18	Q15542	1.60e-15	83.2	800	0.088	0.080	TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3
19	Q4V8C4	1.70e-15	80.5	328	0.096	0.213	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
20	Q8C092	2.55e-15	82.4	801	0.088	0.080	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.065	24.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12773 DZR	5.5e+02	12.0	Double zinc ribbon
3	PF14447 Prok-RING_4	1.2e+02	14.0	Prokaryotic RING finger family 4
4	PF00400 WD40	9.1e-19	78.6	WD domain, G-beta repeat
5	PF17005 WD40_like	2.7	18.9	WD40-like domain
6	PF00097 zf-C3HC4	2.8e-06	38.4	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	1.8e-12	58.2	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.00023	32.2	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	0.023	26.1	zinc finger of C3HC4-type, RING
10	PF12678 zf-rbx1	33	16.2	RING-H2 zinc finger domain
11	PF16685 zf-RING_10	1e+02	14.5	zinc RING finger of MSL2
12	PF17123 zf-RING_11	2.9e+02	12.6	RING-like zinc finger
13	PF13639 zf-RING_2	0.00021	32.9	Ring finger domain
14	PF14570 zf-RING_4	2.8e+02	12.7	RING/Ubox like zinc-binding domain
15	PF14634 zf-RING_5	0.0022	29.2	zinc-RING finger domain
16	PF13445 zf-RING_UBOX	0.00025	32.3	RING-type zinc-finger
17	PF18414 zf_C2H2_10	90	14.0	C2H2 type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301764	0.994	DNA damage-binding protein 1
2	9606.ENSP00000456340	0.993	DET1 homolog
3	9606.ENSP00000364589	0.987	Cullin-4A
4	9606.ENSP00000352928	0.977	DET1- and DDB1-associated protein 1
5	9606.ENSP00000269305	0.971	Cellular tumor antigen p53
6	9606.ENSP00000216225	0.968	E3 ubiquitin-protein ligase RBX1
7	9606.ENSP00000304102	0.950	COP9 signalosome complex subunit 6
8	9606.ENSP00000346340	0.950	COP9 signalosome complex subunit 8
9	9606.ENSP00000384109	0.948	Cullin-4B
10	9606.ENSP00000299259	0.947	COP9 signalosome complex subunit 2
11	9606.ENSP00000256996	0.933	DNA damage-binding protein 2
12	9606.ENSP00000306894	0.931	ETS translocation variant 5
13	9606.ENSP00000350512	0.930	COP9 signalosome complex subunit 5
14	9606.ENSP00000384211	0.930	Proteasome activator complex subunit 4
15	9606.ENSP00000217233	0.928	Tribbles homolog 3
16	9606.ENSP00000312150	0.926	Tribbles homolog 1
17	9606.ENSP00000393183	0.926	DDB1- and CUL4-associated factor 1
18	9606.ENSP00000264389	0.925	COP9 signalosome complex subunit 4
19	9606.ENSP00000265038	0.925	DNA excision repair protein ERCC-8
20	9606.ENSP00000362710	0.925	COP9 signalosome complex subunit 7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019787	0.996	ubiquitin-like protein transferase activity
GO:0004842	0.994	ubiquitin-protein transferase activity
GO:0061630	0.981	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.991	protein metabolic process
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048522	0.965	positive regulation of cellular process
GO:0044260	0.957	cellular macromolecule metabolic process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0009893	0.956	positive regulation of metabolic process
GO:0050896	0.952	response to stimulus
GO:1903050	0.947	regulation of proteolysis involved in protein catabolic process
GO:0061136	0.925	regulation of proteasomal protein catabolic process
GO:0045732	0.917	positive regulation of protein catabolic process
GO:0045862	0.914	positive regulation of proteolysis
GO:1903052	0.904	positive regulation of proteolysis involved in protein catabolic process
GO:2000058	0.900	regulation of ubiquitin-dependent protein catabolic process
GO:0031325	0.892	positive regulation of cellular metabolic process
GO:0032434	0.885	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0030163	0.882	protein catabolic process
GO:2000060	0.854	positive regulation of ubiquitin-dependent protein catabolic process
GO:0006508	0.785	proteolysis
GO:0010212	0.776	response to ionizing radiation
GO:1901800	0.600	positive regulation of proteasomal protein catabolic process
GO:0032436	0.437	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0006511	0.435	ubiquitin-dependent protein catabolic process
GO:0051716	0.391	cellular response to stimulus
GO:0010498	0.389	proteasomal protein catabolic process
GO:0036211	0.333	protein modification process
GO:0048519	0.317	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0000151	0.996	ubiquitin ligase complex
GO:0005829	0.992	cytosol
GO:0031461	0.912	cullin-RING ubiquitin ligase complex
GO:0080008	0.897	Cul4-RING E3 ubiquitin ligase complex
GO:0012505	0.503	endomembrane system
GO:0016020	0.481	membrane
GO:0043228	0.350	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.996	Transferases.

[back to server]