StarFunc result for job id Q8NHY3

User Input

>input (880 residues)
MSQPAGGRRKPRTLGPPVCSIRPFKSSEQYLEAMKEDLAEWLRDLYGLDIDAANFLQVLE
TGLVLCQHANVVTDAALAFLAEAPAQAQKIPMPRVGVSCNGAAQPGTFQARDNVSNFIQW
CRKEMGIQEVLMFETEDLVLRKNVKNVVLCLLELGRRAWRFGVAAPTLVQLEEEIEEEVR
RELALPPPDPSPPAPPRRQPCHFRNLDQMVQSLVSHCTCPVQFSMVKVSEGKYRVGDSNT
LIFIRILRNHVMVRVGGGWDTLGHYLDKHDPCRCTSLSHKPGSFLKPPAPPVQHEVRVQD
GPSQTQPTMTISRSQSPPPPVDWKTYTSSDRRLRPPTPSSPRPRRERGAGTGASREMAPF
LRCQERSLIPSWRQPTAGDSPPSPQSSSTQKGRDPQCTSSGKREERYPPELPRGRIPTSW
VHEETDSWGTDAGNPTPQRLRAIEATTKGISARGPSPLPRSFGPAECLGLRLPLRDEAKG
AFFQFREPESVRSPTPVQGLTKIPIRLPPARPPTPGRSFPGATSGSPRTELGRDPIPLRA
VTVDLAGSTHGDCSVEVRQEDQQLDIQVMAEARESWDLGLQEQEGRYTPLPLGGNKEQAI
YCSLEEEILGNMKLLEVRSACPQGTRSGVIPRSGVYIPRLAGQWPEPGGPYDKAIQELAQ
GSPSLLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVP
PQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKLRPRI
RPRRDHRPEKQPSRIPRPLAYVFLGPARQPPKDRLLRAVLGSKGGEASRVDGASVGEEEE
EGKEEKEPAAPLESSPQPPEGLQPHWLNQAPLPPEEESWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NHY3	0.999	0.999	0.000	880	1.000	1.000	Q8NHY3.pdb.gz	GA2L2_HUMAN GAS2-like protein 2 OS=Homo sapiens OX=9606 GN=GAS2L2 PE=1 SV=1
2	AFDB:Q5SSG4	0.353	0.361	1.044E-88	860	0.672	0.687	Q5SSG4.pdb.gz	GA2L2_MOUSE GAS2-like protein 2 OS=Mus musculus OX=10090 GN=Gas2l2 PE=1 SV=1
3	AFDB:D3ZUE1	0.356	0.365	1.570E-88	857	0.670	0.688	D3ZUE1.pdb.gz	GA2L2_RAT GAS2-like protein 2 OS=Rattus norvegicus OX=10116 GN=Gas2l2 PE=1 SV=1
4	AFDB:Q9W3Y4	0.275	0.249	6.523E-33	977	0.268	0.242	Q9W3Y4.pdb.gz	GA2PE_DROME GAS2-like protein pickled eggs OS=Drosophila melanogaster OX=7227 GN=pigs PE=2 SV=2
5	AFDB:Q54YZ6	0.121	0.089	3.148E-4	1218	0.119	0.086	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
6	AFDB:A0A0B4KEU9	0.056	0.060	7.791E-3	804	0.130	0.142	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:Q8IVL0	0.122	0.053	1.172E-2	2385	0.148	0.055	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
8	AFDB:Q7YSI9	0.113	0.063	3.551E-2	1654	0.158	0.084	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
9	AFDB:Q8IVL1	0.114	0.051	6.004E-2	2488	0.190	0.067	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
10	AFDB:Q80TN7	0.113	0.047	6.365E-2	2359	0.153	0.057	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
11	PDB:7ag0A	0.030	0.109	9.657E-1	140	0.024	0.150	7ag0A.pdb.gz
12	PDB:7pzyO	0.054	0.172	1.453	150	0.025	0.147	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
13	PDB:4gwqG	0.050	0.129	2.062	170	0.016	0.082	4gwqG.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
14	PDB:7dvqK	0.048	0.128	2.062	188	0.037	0.176	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3rb9A	0.043	0.082	2.186	395	0.018	0.041	3rb9A.pdb.gz
16	PDB:5abbA	0.053	0.085	2.186	443	0.033	0.065	5abbA.pdb.gz
17	PDB:4rj9A	0.033	0.138	2.317	161	0.013	0.068	4rj9A.pdb.gz
18	PDB:3venA	0.062	0.076	2.456	571	0.036	0.056	3venA.pdb.gz	The O-Carbamoyltransferase TobZ Catalyzes an Ancient Enzymatic Reaction.
19	PDB:2byoA	0.035	0.151	2.760	183	0.006	0.027	2byoA.pdb.gz	Lppx is a Lipoprotein Required for the Translocation of Phthiocerol Dimycocerosates to the Surface of Mycobacterium Tuberculosis.
20	PDB:6snoA	0.032	0.043	2.760	573	0.015	0.023	6snoA.pdb.gz	Structural basis for substrate and product recognition in human phosphoglucomutase-1 (PGM1) isoform 2, a member of the alpha-D-phosphohexomutase superfamily.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZUE1	0.0	1011	857	0.668	0.686	GA2L2_RAT GAS2-like protein 2 OS=Rattus norvegicus OX=10116 GN=Gas2l2 PE=1 SV=1
2	Q5SSG4	0.0	1018	860	0.676	0.692	GA2L2_MOUSE GAS2-like protein 2 OS=Mus musculus OX=10090 GN=Gas2l2 PE=1 SV=1
3	Q8NHY3	0.0	1768	880	1.000	1.000	GA2L2_HUMAN GAS2-like protein 2 OS=Homo sapiens OX=9606 GN=GAS2L2 PE=1 SV=1
4	A0A1L8H8C0	2.64e-132	421	956	0.237	0.219	G2L2S_XENLA GAS2-like protein 2B OS=Xenopus laevis OX=8355 GN=gas2l2.S PE=3 SV=1
5	A0A1L8HFX9	2.87e-131	419	980	0.260	0.234	G2L2L_XENLA GAS2-like protein 2A OS=Xenopus laevis OX=8355 GN=gas2l2.L PE=3 SV=1
6	Q8JZP9	1.95e-92	308	678	0.183	0.237	GA2L1_MOUSE GAS2-like protein 1 OS=Mus musculus OX=10090 GN=Gas2l1 PE=1 SV=1
7	Q99501	5.12e-86	291	681	0.181	0.233	GA2L1_HUMAN GAS2-like protein 1 OS=Homo sapiens OX=9606 GN=GAS2L1 PE=1 SV=2
8	P11862	1.15e-52	188	314	0.128	0.360	GAS2_MOUSE Growth arrest-specific protein 2 OS=Mus musculus OX=10090 GN=Gas2 PE=1 SV=1
9	O43903	1.09e-51	186	313	0.127	0.358	GAS2_HUMAN Growth arrest-specific protein 2 OS=Homo sapiens OX=9606 GN=GAS2 PE=1 SV=1
10	Q9W3Y4	2.11e-47	185	977	0.103	0.093	GA2PE_DROME GAS2-like protein pickled eggs OS=Drosophila melanogaster OX=7227 GN=pigs PE=2 SV=2
11	Q86XJ1	2.45e-46	179	694	0.119	0.151	GA2L3_HUMAN GAS2-like protein 3 OS=Homo sapiens OX=9606 GN=GAS2L3 PE=1 SV=1
12	Q3UWW6	2.73e-46	179	683	0.117	0.151	GA2L3_MOUSE GAS2-like protein 3 OS=Mus musculus OX=10090 GN=Gas2l3 PE=1 SV=1
13	Q1L8E6	6.27e-42	164	550	0.117	0.187	Q1L8E6_DANRE GAS2-like protein 3 OS=Danio rerio OX=7955 GN=fc11d07 PE=2 SV=1
14	A0A0B4K718	3.95e-16	86.3	4100	0.050	0.011	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	Q8MR19	3.96e-16	85.9	1140	0.050	0.039	Q8MR19_DROME LD39385p (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
16	E1JH62	5.48e-16	85.9	5388	0.050	0.008	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A0A0B4K7P8	5.52e-16	85.9	5394	0.050	0.008	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG4	5.52e-16	85.9	5368	0.050	0.008	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	A0A0B4K7Y9	5.57e-16	85.9	5408	0.050	0.008	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	A1Z9I9	5.57e-16	85.9	5390	0.050	0.008	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00307 CH	2.8e-12	58.1	Calponin homology (CH) domain
2	PF02187 GAS2	9e-31	117.0	Growth-Arrest-Specific Protein 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000474529

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216101	0.782	Ras-like protein family member 10A
2	9606.ENSP00000343331	0.768	Lipase member I
3	9606.ENSP00000432305	0.764	Sperm surface protein Sp17
4	9606.ENSP00000386770	0.704	Dynein heavy chain 10, axonemal
5	9606.ENSP00000261383	0.692	Dynein heavy chain 3, axonemal
6	9606.ENSP00000374045	0.683	Dynein heavy chain 6, axonemal
7	9606.ENSP00000462435	0.630	Tubulin polymerization-promoting protein family member 3
8	9606.ENSP00000367542	0.585	Tropomyosin beta chain
9	9606.ENSP00000475939	0.565	Dynein heavy chain 11, axonemal
10	9606.ENSP00000357079	0.546	Cilia and flagella associated protein 45
11	9606.ENSP00000311899	0.528	Dynein assembly factor with WDR repeat domains 1
12	9606.ENSP00000275358	0.526	Von Willebrand factor D and EGF domains
13	9606.ENSP00000266397	0.518	Endoplasmic reticulum protein 27
14	9606.ENSP00000458355	0.517	Dynein heavy chain 2, axonemal
15	9606.ENSP00000318429	0.515	Coiled-coil domain-containing protein 114

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0008017	1.000	microtubule binding
GO:0030674	0.925	protein-macromolecule adaptor activity
GO:0008093	0.921	cytoskeletal anchor activity
GO:0044877	0.865	protein-containing complex binding
GO:0051015	0.848	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0009987	0.977	cellular process
GO:0032886	0.977	regulation of microtubule-based process
GO:0060632	0.961	regulation of microtubule-based movement
GO:0007017	0.945	microtubule-based process
GO:0071840	0.927	cellular component organization or biogenesis
GO:0003352	0.886	regulation of cilium movement
GO:0051493	0.879	regulation of cytoskeleton organization
GO:1902019	0.833	regulation of cilium-dependent cell motility
GO:0016043	0.769	cellular component organization
GO:0006996	0.688	organelle organization
GO:0060295	0.685	regulation of cilium movement involved in cell motility
GO:0048523	0.631	negative regulation of cellular process
GO:0007010	0.624	cytoskeleton organization
GO:1901879	0.479	regulation of protein depolymerization
GO:0031110	0.428	regulation of microtubule polymerization or depolymerization
GO:0000226	0.417	microtubule cytoskeleton organization
GO:0033365	0.386	protein localization to organelle
GO:0065008	0.382	regulation of biological quality
GO:0001578	0.355	microtubule bundle formation
GO:1902903	0.353	regulation of supramolecular fiber organization
GO:0010639	0.343	negative regulation of organelle organization
GO:0044380	0.338	protein localization to cytoskeleton
GO:1901880	0.315	negative regulation of protein depolymerization
GO:0031114	0.312	regulation of microtubule depolymerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0015630	0.997	microtubule cytoskeleton
GO:0005929	0.990	cilium
GO:0005886	0.987	plasma membrane
GO:0099512	0.978	supramolecular fiber
GO:0005737	0.968	cytoplasm
GO:0099513	0.956	polymeric cytoskeletal fiber
GO:0005874	0.942	microtubule
GO:0005815	0.855	microtubule organizing center
GO:0036064	0.842	ciliary basal body
GO:1990752	0.748	microtubule end
GO:0015629	0.736	actin cytoskeleton
GO:0032991	0.369	protein-containing complex
GO:0005884	0.353	actin filament
GO:0043231	0.345	intracellular membrane-bounded organelle
GO:0032432	0.344	actin filament bundle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]