StarFunc result for job id Q8NHZ7

User Input

>input (208 residues)
MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
GTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
RVKKARERLAKALQADRLARRAEMLTGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NE82	0.372	0.372	9.595E-28	208	0.981	0.981	A6NE82.pdb.gz	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
2	AFDB:O46085	0.176	0.076	2.100E-1	614	0.135	0.046	O46085.pdb.gz	O46085_DROME GH08708p OS=Drosophila melanogaster OX=7227 GN=Pex5 PE=1 SV=2
3	AFDB:Q5AB69	0.162	0.119	3.380E-1	283	0.144	0.106	Q5AB69.pdb.gz	Q5AB69_CANAL Rca1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RCA1 PE=4 SV=1
4	AFDB:P49379	0.137	0.083	5.440E-1	359	0.139	0.081	P49379.pdb.gz	CBF1_KLULA Centromere-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=CBF1 PE=1 SV=2
5	AFDB:Q8NAX2	0.130	0.071	1.074	398	0.168	0.088	Q8NAX2.pdb.gz	KDF1_HUMAN Keratinocyte differentiation factor 1 OS=Homo sapiens OX=9606 GN=KDF1 PE=1 SV=2
6	AFDB:C0SPG1	0.126	0.092	1.230	302	0.125	0.086	C0SPG1.pdb.gz	ZAR2A_XENLA Zygote arrest protein 2.S OS=Xenopus laevis OX=8355 GN=zar2.S PE=1 SV=1
7	AFDB:Q7JNE1	0.165	0.106	1.230	346	0.183	0.110	Q7JNE1.pdb.gz	Q7JNE1_DROME Regulatory protein zeste OS=Drosophila melanogaster OX=7227 GN=prod PE=1 SV=1
8	AFDB:F4JTJ2	0.144	0.052	1.409	723	0.168	0.048	F4JTJ2.pdb.gz	EREL1_ARATH PX domain-containing protein EREL1 OS=Arabidopsis thaliana OX=3702 GN=EREL1 PE=2 SV=1
9	AFDB:P02929	0.095	0.085	1.409	239	0.111	0.096	P02929.pdb.gz	TONB_ECOLI Protein TonB OS=Escherichia coli (strain K12) OX=83333 GN=tonB PE=1 SV=2
10	AFDB:O01501	0.095	0.050	1.508	524	0.111	0.044	O01501.pdb.gz	CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans OX=6239 GN=cye-1 PE=1 SV=2
11	PDB:7ungi	0.129	0.112	4.914	250	0.139	0.116	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:5gm6P	0.143	0.123	6.449	246	0.139	0.118	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7mqaNA	0.116	0.087	8.465	295	0.130	0.092	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7jtsE	0.085	0.402	9.060	40	0.014	0.075	7jtsE.pdb.gz
15	PDB:7oyaL1	0.120	0.126	9.060	197	0.043	0.046	7oyaL1.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
16	PDB:5aj0AD	0.125	0.093	9.698	294	0.053	0.037	5aj0AD.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:7qsor	0.073	0.142	9.698	96	0.082	0.177	7qsor.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8NHZ7	3.47e-149	414	208	1.000	1.000	MB3L2_HUMAN Methyl-CpG-binding domain protein 3-like 2 OS=Homo sapiens OX=9606 GN=MBD3L2 PE=1 SV=3
2	A6NE82	2.81e-145	404	208	0.981	0.981	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
3	Q8WWY6	4.73e-31	114	194	0.361	0.387	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
4	A0A8I6GL26	8.65e-18	81.3	262	0.293	0.233	A0A8I6GL26_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
5	A0A8I6ANN7	9.08e-18	80.9	257	0.303	0.245	A0A8I6ANN7_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
6	Q9Z2D8	1.53e-17	80.9	285	0.303	0.221	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
7	O95983	1.68e-17	80.9	291	0.274	0.196	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
8	B2RZ64	2.81e-17	80.5	308	0.293	0.198	B2RZ64_RAT Mbd3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=2 SV=1
9	F7EY92	7.87e-17	79.0	282	0.264	0.195	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
10	Q9UBB5	1.23e-16	79.3	411	0.288	0.146	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
11	D4A986	1.44e-16	79.3	412	0.284	0.143	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
12	B0BNM2	1.54e-16	79.3	412	0.284	0.143	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
13	Q9Z2E1	2.39e-16	78.6	414	0.288	0.145	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
14	Q7ZZR0	5.67e-16	75.9	242	0.250	0.215	Q7ZZR0_DANRE Mbd3b protein OS=Danio rerio OX=7955 GN=mdb3b PE=1 SV=1
15	A0A2R8QPC3	1.02e-15	75.5	265	0.250	0.196	A0A2R8QPC3_DANRE Methyl-CpG binding domain protein 3b isoform X1 OS=Danio rerio OX=7955 GN=cb357 PE=1 SV=1
16	Q9V424	2.68e-10	60.1	226	0.202	0.186	Q9V424_DROME Methyl-CpG binding domain protein-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
17	Q9VHB7	1.85e-09	58.5	339	0.202	0.124	Q9VHB7_DROME LD22928p OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=2
18	A0A0B4KGZ0	2.04e-09	58.5	340	0.202	0.124	A0A0B4KGZ0_DROME Methyl-CpG binding domain protein-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
19	Q84LG2	2.0	31.6	389	0.072	0.039	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
20	Q8IWW6	2.3	31.6	846	0.106	0.026	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16564 MBDa	5.1e-27	105.2	p55-binding region of Methyl-CpG-binding domain proteins MBD
2	PF14048 MBD_C	1.3e-13	62.8	C-terminal domain of methyl-CpG binding protein 2 and 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.963	Histone deacetylase 1
2	9606.ENSP00000369424	0.947	Histone-binding protein RBBP7
3	9606.ENSP00000278823	0.946	Metastasis-associated protein MTA2
4	9606.ENSP00000362592	0.946	Histone-binding protein RBBP4
5	9606.ENSP00000349508	0.943	Chromodomain-helicase-DNA-binding protein 4
6	9606.ENSP00000430432	0.942	Histone deacetylase 2
7	9606.ENSP00000353463	0.932	Transcriptional repressor p66-alpha
8	9606.ENSP00000256429	0.927	Methyl-CpG-binding domain protein 2
9	9606.ENSP00000412302	0.927	Methyl-CpG-binding domain protein 3
10	9606.ENSP00000369716	0.921	Chromodomain-helicase-DNA-binding protein 3
11	9606.ENSP00000357644	0.910	Transcriptional repressor p66-beta
12	9606.ENSP00000272395	0.790	Tripartite motif containing 43
13	9606.ENSP00000365322	0.765	PRAME family member 9
14	9606.ENSP00000240189	0.742	PRAME family member 2
15	9606.ENSP00000380053	0.733	PRD class homeoboxes and pseudogenes
16	9606.ENSP00000321963	0.730	Zinc finger and SCAN domain-containing protein 4
17	9606.ENSP00000432816	0.717	Acrosomal vesicle protein 1
18	9606.ENSP00000480122	0.702	PRAME family member 5
19	9606.ENSP00000360644	0.689	Dolichol-phosphate mannosyltransferase subunit 1
20	9606.ENSP00000365360	0.666	PRAME family member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.406	heterocyclic compound binding
GO:0097159	0.406	organic cyclic compound binding
GO:0003676	0.401	nucleic acid binding
GO:0003677	0.381	DNA binding
GO:0043565	0.348	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.966	regulation of cellular process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0080090	0.923	regulation of primary metabolic process
GO:0008152	0.902	metabolic process
GO:0031323	0.899	regulation of cellular metabolic process
GO:0071704	0.891	organic substance metabolic process
GO:0044238	0.882	primary metabolic process
GO:0006807	0.874	nitrogen compound metabolic process
GO:0071840	0.834	cellular component organization or biogenesis
GO:0043170	0.830	macromolecule metabolic process
GO:0048519	0.818	negative regulation of biological process
GO:0016043	0.805	cellular component organization
GO:0048523	0.751	negative regulation of cellular process
GO:0019219	0.749	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.726	regulation of gene expression
GO:0009892	0.488	negative regulation of metabolic process
GO:1901564	0.468	organonitrogen compound metabolic process
GO:0010556	0.460	regulation of macromolecule biosynthetic process
GO:0031326	0.458	regulation of cellular biosynthetic process
GO:0051252	0.457	regulation of RNA metabolic process
GO:0019538	0.454	protein metabolic process
GO:2001141	0.445	regulation of RNA biosynthetic process
GO:0010605	0.425	negative regulation of macromolecule metabolic process
GO:1903506	0.421	regulation of nucleic acid-templated transcription
GO:0051172	0.405	negative regulation of nitrogen compound metabolic process
GO:0031324	0.405	negative regulation of cellular metabolic process
GO:0006338	0.386	chromatin remodeling
GO:0006355	0.362	regulation of DNA-templated transcription
GO:0045934	0.359	negative regulation of nucleobase-containing compound metabolic process
GO:0016570	0.355	histone modification
GO:0010558	0.327	negative regulation of macromolecule biosynthetic process
GO:0031327	0.324	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005634	1.000	nucleus
GO:0043233	0.997	organelle lumen
GO:0032991	0.995	protein-containing complex
GO:0000785	0.992	chromatin
GO:0005654	0.990	nucleoplasm
GO:1902494	0.987	catalytic complex
GO:0140513	0.986	nuclear protein-containing complex
GO:0000118	0.981	histone deacetylase complex
GO:0005667	0.960	transcription regulator complex
GO:0005737	0.770	cytoplasm
GO:0070603	0.734	SWI/SNF superfamily-type complex
GO:0090545	0.678	CHD-type complex
GO:0016581	0.604	NuRD complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]