StarFunc result for job id Q8NI08

User Input

>input (942 residues)
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVE
EEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGN
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVPLEKSTGHTPT
KPSGSSVSEKLKKLDSSRETSHGSPTVTKLSKEPSDTSSAFESTAKENFLGEDDDFVDLE
ELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVELKG
ALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENL
QKTELSDGKSIEPGGIDITLSSSLSQAGDPITEGNKEPDKTWVKKGEPLPVKLNSSTEAN
VIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPHS
ALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN
QIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6DFV7	0.273	0.273	0.000	943	0.824	0.823	Q6DFV7.pdb.gz	NCOA7_MOUSE Nuclear receptor coactivator 7 OS=Mus musculus OX=10090 GN=Ncoa7 PE=1 SV=2
2	AFDB:Q8NI08	1.000	1.000	0.000	942	1.000	1.000	Q8NI08.pdb.gz	NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2
3	AFDB:Q8N573	0.222	0.237	6.950E-62	874	0.349	0.376	Q8N573.pdb.gz	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
4	AFDB:A2ACG1	0.182	0.854	2.762E-27	198	0.092	0.439	A2ACG1.pdb.gz	TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1
5	AFDB:Q7KTR8	0.183	0.637	2.053E-26	267	0.104	0.367	Q7KTR8.pdb.gz	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
6	PDB:7fdeP	0.171	0.840	3.662E-15	181	0.068	0.354	7fdeP.pdb.gz
7	PDB:7uneU	0.175	0.376	4.019E-14	427	0.054	0.119	7uneU.pdb.gz
8	PDB:5jceB	0.049	0.152	1.477E-2	297	0.016	0.051	5jceB.pdb.gz
9	PDB:1lw3A	0.055	0.097	3.407E-2	513	0.012	0.021	1lw3A.pdb.gz
10	AFDB:Q9W002	0.071	0.049	8.297E-2	1504	0.159	0.100	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
11	PDB:6xtbE	0.054	0.200	9.288E-2	235	0.010	0.038	6xtbE.pdb.gz
12	PDB:5yqrA	0.048	0.164	1.714E-1	268	0.006	0.022	5yqrA.pdb.gz
13	PDB:4mk0A	0.051	0.075	2.677E-1	631	0.010	0.014	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:3uzsA	0.054	0.081	2.830E-1	609	0.010	0.015	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
15	PDB:6r9tA	0.051	0.023	2.830E-1	2185	0.007	0.003	6r9tA.pdb.gz
16	PDB:3ghgI	0.080	0.152	2.992E-1	394	0.042	0.102	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
17	AFDB:B7YZK8	0.053	0.037	5.831E-1	1517	0.109	0.068	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	AFDB:Q8L7W3	0.052	0.053	6.165E-1	878	0.115	0.123	Q8L7W3.pdb.gz	Q8L7W3_ARATH At2g29210/F16P2.41 OS=Arabidopsis thaliana OX=3702 GN=At2g29210 PE=1 SV=1
19	AFDB:O14367	0.037	0.046	8.613E-1	720	0.089	0.117	O14367.pdb.gz	GTI1_SCHPO Gluconate transport inducer 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gti1 PE=4 SV=1
20	AFDB:P51521	0.039	0.028	9.106E-1	1351	0.118	0.082	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6DFV7	0.0	1449	943	0.811	0.810	NCOA7_MOUSE Nuclear receptor coactivator 7 OS=Mus musculus OX=10090 GN=Ncoa7 PE=1 SV=2
2	Q8NI08	0.0	1948	942	1.000	1.000	NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2
3	Q4V8B0	2.91e-101	337	839	0.169	0.190	OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3
4	Q8N573	4.33e-100	335	874	0.173	0.186	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
5	Q4KMM3	1.45e-99	333	866	0.173	0.188	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
6	B7Z0T6	1.06e-76	269	789	0.144	0.172	B7Z0T6_DROME Mustard, isoform R OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
7	Q8IPN8	3.18e-76	269	869	0.144	0.157	Q8IPN8_DROME L82C OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
8	A0A0B4KF88	3.19e-76	269	871	0.144	0.156	A0A0B4KF88_DROME Mustard, isoform AA OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	Q7KNC5	1.18e-75	270	1025	0.144	0.133	Q7KNC5_DROME L82B OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
10	Q8MSQ5	1.35e-75	270	1033	0.144	0.132	Q8MSQ5_DROME Mustard, isoform G OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
11	Q4ABH3	1.73e-75	270	1012	0.144	0.134	Q4ABH3_DROME Mustard, isoform M OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
12	B7Z0T3	2.22e-75	270	1106	0.144	0.123	B7Z0T3_DROME Mustard, isoform S OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
13	A0A0B4K699	3.49e-75	270	1158	0.144	0.117	A0A0B4K699_DROME Mustard, isoform Y OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
14	Q9VNA1	5.03e-75	271	1270	0.144	0.107	Q9VNA1_DROME L82A OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=2
15	A4V2F2	5.62e-75	270	1246	0.144	0.109	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
16	Q0KIB9	6.73e-75	271	1314	0.144	0.104	Q0KIB9_DROME Mustard, isoform P OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
17	Q8IPN9	4.21e-73	263	1055	0.151	0.135	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
18	Q9VNA2	5.14e-73	264	1127	0.151	0.126	Q9VNA2_DROME Mustard, isoform X OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=3
19	A0A0B4K6S8	7.77e-73	264	1180	0.151	0.120	A0A0B4K6S8_DROME Mustard, isoform W OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
20	A0A0B4K620	1.33e-72	264	1344	0.151	0.106	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02893 GRAM	1.2e+02	14.0	GRAM domain
2	PF01476 LysM	4.7e-05	34.7	LysM domain
3	PF07534 TLD	7.2e-34	128.4	TLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376269

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.997	Estrogen receptor
2	9606.ENSP00000343925	0.855	Estrogen receptor beta
3	9606.ENSP00000370968	0.640	Myb-binding protein 1A
4	9606.ENSP00000300651	0.625	Mediator of RNA polymerase II transcription subunit 1
5	9606.ENSP00000234396	0.623	V-type proton ATPase subunit B, kidney isoform
6	9606.ENSP00000352282	0.575	Kelch domain containing 1
7	9606.ENSP00000352536	0.570	General transcription factor 3C polypeptide 2
8	9606.ENSP00000468354	0.570	Ankyrin repeat domain-containing protein 29
9	9606.ENSP00000379904	0.545	Thyroid hormone receptor beta
10	9606.ENSP00000287820	0.535	Peroxisome proliferator-activated receptor gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030374	1.000	nuclear receptor coactivator activity
GO:0016922	1.000	nuclear receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0048518	0.964	positive regulation of biological process
GO:0009889	0.942	regulation of biosynthetic process
GO:0045893	0.901	positive regulation of DNA-templated transcription
GO:0006357	0.889	regulation of transcription by RNA polymerase II
GO:0045944	0.685	positive regulation of transcription by RNA polymerase II
GO:0048583	0.495	regulation of response to stimulus
GO:0009987	0.410	cellular process
GO:0050896	0.399	response to stimulus
GO:0048519	0.388	negative regulation of biological process
GO:0008152	0.349	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005829	0.909	cytosol
GO:0016020	0.892	membrane
GO:0005730	0.661	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]