StarFunc result for job id Q8NI17

User Input

>input (732 residues)
MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYA
FGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIA
KTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRK
DKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAE
ADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWV
SMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWF
PDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV
PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYG
LESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVA
YGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPS
DKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVS
PEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLV
SEKLPEHTKGEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NI17	1.000	1.000	0.000	732	1.000	1.000	Q8NI17.pdb.gz	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
2	AFDB:P40190	0.659	0.533	2.452E-46	918	0.251	0.200	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
3	AFDB:Q00560	0.659	0.534	3.260E-46	917	0.247	0.197	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
4	AFDB:Q99062	0.389	0.348	1.174E-41	836	0.240	0.211	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
5	AFDB:D4A3R0	0.423	0.384	4.434E-39	838	0.219	0.191	D4A3R0.pdb.gz	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
6	AFDB:P97378	0.525	0.449	1.260E-38	874	0.212	0.177	P97378.pdb.gz	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
7	AFDB:F1LRH7	0.522	0.448	1.524E-38	869	0.210	0.177	F1LRH7.pdb.gz	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
8	AFDB:P40223	0.406	0.365	2.124E-38	837	0.220	0.192	P40223.pdb.gz	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
9	AFDB:Q99665	0.545	0.471	4.648E-37	862	0.220	0.187	Q99665.pdb.gz	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
10	AFDB:O70535	0.520	0.369	6.180E-37	1093	0.194	0.130	O70535.pdb.gz	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
11	PDB:7q1yA	0.141	0.088	1.052E-11	1374	0.081	0.043	7q1yA.pdb.gz
12	PDB:8dtlA	0.151	0.149	6.699E-11	741	0.071	0.070	8dtlA.pdb.gz
13	PDB:4rtdA	0.116	0.083	9.339E-11	1122	0.070	0.045	4rtdA.pdb.gz
14	PDB:8eyyA	0.158	0.156	1.027E-10	775	0.078	0.074	8eyyA.pdb.gz
15	PDB:6pxvA	0.171	0.153	1.501E-10	823	0.087	0.078	6pxvA.pdb.gz
16	PDB:1e07A	0.158	0.175	4.266E-10	642	0.086	0.098	1e07A.pdb.gz
17	PDB:5oj2B	0.109	0.115	4.266E-10	692	0.082	0.087	5oj2B.pdb.gz
18	PDB:7q5zA	0.116	0.076	5.158E-10	1344	0.082	0.045	7q5zA.pdb.gz
19	PDB:6h03A	0.140	0.099	5.409E-10	1223	0.071	0.043	6h03A.pdb.gz
20	PDB:6pyhD	0.161	0.151	9.562E-10	798	0.079	0.073	6pyhD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K5B1	0.0	788	716	0.597	0.610	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
2	Q8NI17	0.0	1514	732	1.000	1.000	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
3	P40189	4.22e-69	246	918	0.221	0.176	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
4	Q00560	6.13e-69	245	917	0.238	0.190	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
5	Q17RA0	7.70e-69	245	918	0.221	0.176	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
6	P40190	1.36e-66	239	918	0.242	0.193	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
7	F1RCZ2	8.42e-63	227	859	0.240	0.205	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
8	A8WH79	1.12e-56	210	866	0.234	0.197	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
9	Q99062	1.41e-41	165	836	0.219	0.191	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
10	D4A3R0	5.99e-40	160	849	0.208	0.179	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
11	P40223	4.90e-39	157	837	0.209	0.183	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
12	A0A8I6B3M3	1.07e-36	150	877	0.209	0.174	A0A8I6B3M3_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=1
13	F1LRH7	1.19e-29	128	869	0.202	0.170	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
14	F1R904	1.50e-27	121	810	0.204	0.184	F1R904_DANRE Colony-stimulating factor 3 receptor (granulocyte) OS=Danio rerio OX=7955 GN=gcsfr PE=3 SV=1
15	P42702	4.27e-26	117	1097	0.186	0.124	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
16	A8Y5W0	1.02e-25	115	810	0.201	0.181	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
17	P42703	1.37e-25	115	1092	0.195	0.131	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
18	O70535	1.57e-24	112	1093	0.190	0.127	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1
19	P97378	2.25e-24	111	874	0.197	0.165	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
20	Q99665	5.48e-24	110	862	0.189	0.160	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	0.0067	28.0	Erythropoietin receptor, ligand binding
2	PF00041 fn3	1.1e-19	81.9	Fibronectin type III domain
3	PF18707 IL2RB_N1	0.002	30.0	Interleukin-2 receptor subunit beta N-terminal domain 1
4	PF09238 IL4Ra_N	18	17.1	Interleukin-4 receptor alpha chain, N-terminal
5	PF09240 IL6Ra-bind	0.00012	33.8	Interleukin-6 receptor alpha chain, binding
6	PF09294 Interfer-bind	35	16.1	Interferon-alpha/beta receptor, fibronectin type III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366234	0.994	Interleukin-31
2	9606.ENSP00000274276	0.888	Oncostatin-M-specific receptor subunit beta
3	9606.ENSP00000343204	0.877	Tyrosine-protein kinase JAK1
4	9606.ENSP00000278353	0.681	Very-long-chain 3-oxoacyl-CoA reductase
5	9606.ENSP00000264563	0.654	Interleukin-11
6	9606.ENSP00000249075	0.644	Leukemia inhibitory factor
7	9606.ENSP00000338207	0.615	Rhombotin-1
8	9606.ENSP00000215781	0.609	Oncostatin-M
9	9606.ENSP00000424838	0.606	Probable ATP-dependent RNA helicase DDX4
10	9606.ENSP00000371067	0.580	Tyrosine-protein kinase JAK2
11	9606.ENSP00000354681	0.546	Dynamin-like 120 kDa protein, mitochondrial
12	9606.ENSP00000356920	0.518	Dual specificity protein phosphatase 12
13	9606.ENSP00000365651	0.507	Natriuretic peptides B
14	9606.ENSP00000260947	0.506	BRCA1-associated RING domain protein 1
15	9606.ENSP00000346839	0.502	Fibronectin type III domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0005515	0.997	protein binding
GO:0019955	0.392	cytokine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0009987	0.986	cellular process
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0007154	0.975	cell communication
GO:0051716	0.970	cellular response to stimulus
GO:0001934	0.968	positive regulation of protein phosphorylation
GO:0050731	0.951	positive regulation of peptidyl-tyrosine phosphorylation
GO:0019221	0.940	cytokine-mediated signaling pathway
GO:0008284	0.913	positive regulation of cell population proliferation
GO:0042509	0.906	regulation of tyrosine phosphorylation of STAT protein
GO:0097696	0.552	receptor signaling pathway via STAT
GO:0032502	0.528	developmental process
GO:0048856	0.522	anatomical structure development
GO:0042531	0.516	positive regulation of tyrosine phosphorylation of STAT protein
GO:0007259	0.404	receptor signaling pathway via JAK-STAT
GO:0048583	0.397	regulation of response to stimulus
GO:0030154	0.367	cell differentiation
GO:0048584	0.347	positive regulation of response to stimulus
GO:0023051	0.305	regulation of signaling
GO:0010646	0.305	regulation of cell communication
GO:0009967	0.302	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.644	organelle
GO:0043227	0.623	membrane-bounded organelle
GO:0032991	0.432	protein-containing complex
GO:0005622	0.343	intracellular anatomical structure
GO:0005737	0.332	cytoplasm
GO:0005576	0.328	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]