StarFunc result for job id Q8NI27

User Input

>input (1593 residues)
MAAAAVVVPAEWIKNWEKSGRGEFLHLCRILSENKSHDSSTYRDFQQALYELSYHVIKGN
LKHEQASNVLSDISEFREDMPSILADVFCILDIETNCLEEKSKRDYFTQLVLACLYLVSD
TVLKERLDPETLESLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIAELG
QDLSGSITSDLILENIKSLIGCFNLDPNRVLDVILEVFECRPEHDDFFISLLESYMSMCE
PQTLCHILGFKFKFYQEPNGETPSSLYRVAAVLLQFNLIDLDDLYVHLLPADNCIMDEHK
REIAEAKQIVRKLTMVVLSSEKMDEREKEKEKEEEKVEKPPDNQKLGLLEALLKIGDWQH
AQNIMDQMPPYYAASHKLIALAICKLIHITIEPLYRRVGVPKGAKGSPVNALQNKRAPKQ
AESFEDLRRDVFNMFCYLGPHLSHDPILFAKVVRIGKSFMKEFQSDGSKQEDKEKTEVIL
SCLLSITDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVK
VKAQTIDRAKYIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDS
LKYLTSLNYDVLAYCIIEALANPEKERMKHDDTTISSWLQSLASFCGAVFRKYPIDLAGL
LQYVANQLKAGKSFDLLILKEVVQKMAGIEITEEMTMEQLEAMTGGEQLKAEGGYFGQIR
NTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLYDQCHDTLVQF
GGFLASNLSTEDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGS
KQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYE
REVNKLKVQMKAIDDNQEMPPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEK
DNWLLAKSTKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDRV
FSDIIYTVASCTENEASRYGRFLCCMLETVTRWHSDRATYEKECGNYPGFLTILRATGFD
GGNKADQLDYENFRHVVHKWHYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNL
GQALERRVHKICQEEKEKRPDLYALAMGYSGQLKSRKSYMIPENEFHHKDPPPRNAVASV
QNGPGGGPSSSSIGSASKSDESSTEETDKSRERSQCGVKAVNKASSTTPKGNSSNGNSGS
NSNKAVKENDKEKGKEKEKEKKEKTPATTPEARVLGKDGKEKPKEERPNKDEKARETKER
TPKSDKEKEKFKKEEKAKDEKFKTTVPNAESKSTQEREREKEPSRERDIAKEMKSKENVK
GGEKTPVSGSLKSPVPRSDIPEPEREQKRRKIDTHPSPSHSSTVKDSLIELKESSAKLYI
NHTPPPLSKSKEREMDKKDLDKSRERSREREKKDEKDRKERKRDHSNNDREVPPDLTKRR
KEENGTMGVSKHKSESPCESPYPNEKDKEKNKSKSSGKEKGSDSFKSEKMDKISSGGKKE
SRHDKEKIEKKEKRDSSGGKEEKKHHKSSDKHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K8V3	0.831	0.821	0.000	1613	0.969	0.957	A0A0G2K8V3.pdb.gz	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
2	AFDB:Q8NI27	0.999	0.999	0.000	1593	1.000	1.000	Q8NI27.pdb.gz	THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2
3	AFDB:F4IAT2	0.651	0.573	1.454E-68	1823	0.301	0.263	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
4	PDB:7v2yB	0.526	0.661	3.767E-30	1226	0.149	0.193	7v2yB.pdb.gz
5	PDB:7apxA	0.512	0.672	4.097E-27	1165	0.137	0.188	7apxA.pdb.gz
6	AFDB:Q6PR54	0.104	0.082	2.782E-10	2419	0.127	0.084	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
7	AFDB:F4J8G7	0.078	0.065	1.445E-9	2138	0.129	0.096	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
8	AFDB:Q5UIP0	0.128	0.099	1.673E-9	2472	0.117	0.076	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
9	AFDB:E1C2U2	0.132	0.106	4.332E-9	2326	0.126	0.086	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
10	AFDB:P29539	0.126	0.110	9.694E-9	1916	0.110	0.091	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
11	PDB:6xu2A	0.099	0.127	1.183E-6	1091	0.082	0.119	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
12	AFDB:Q9VW47	0.119	0.085	1.571E-6	2531	0.112	0.071	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
13	PDB:7qdrB	0.079	0.093	9.534E-6	1212	0.090	0.119	7qdrB.pdb.gz
14	PDB:7mqaSP	0.093	0.069	1.188E-5	2485	0.101	0.065	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3w3zA	0.124	0.164	1.426E-5	1013	0.082	0.129	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:3w3uA	0.096	0.123	1.776E-5	1030	0.090	0.139	3w3uA.pdb.gz
17	PDB:7mq8LM	0.104	0.089	1.776E-5	2005	0.088	0.070	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7r04B	0.113	0.091	2.057E-5	2229	0.084	0.060	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
19	PDB:6tc0C	0.104	0.137	2.966E-5	994	0.075	0.121	6tc0C.pdb.gz
20	AFDB:O95996	0.102	0.080	3.529E-5	2303	0.102	0.070	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K8V3	0.0	3210	1621	0.976	0.959	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
2	B1AZI6	0.0	3225	1594	0.975	0.974	THOC2_MOUSE THO complex subunit 2 OS=Mus musculus OX=10090 GN=Thoc2 PE=1 SV=1
3	E2QCS8	0.0	1156	1642	0.416	0.404	E2QCS8_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
4	F1M0V4	0.0	3180	1604	0.964	0.958	F1M0V4_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=3
5	F4IAT2	0.0	687	1823	0.316	0.276	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
6	M9PE28	0.0	1157	1641	0.416	0.404	M9PE28_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=1
7	Q8NI27	0.0	3301	1593	1.000	1.000	THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2
8	Q9VQ76	0.0	1161	1641	0.416	0.404	Q9VQ76_DROME THO complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=tho2 PE=1 SV=2
9	Q09779	2.25e-155	517	1628	0.252	0.246	THO2_SCHPO THO complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho2 PE=1 SV=3
10	Q960L4	1.24e-130	426	721	0.124	0.275	Q960L4_DROME LD46453p OS=Drosophila melanogaster OX=7227 GN=tho2 PE=2 SV=1
11	P53552	5.28e-43	175	1597	0.161	0.160	THO2_YEAST THO complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THO2 PE=1 SV=1
12	Q8II80	1.8	35.8	1570	0.021	0.022	Q8II80_PLAF7 ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1128300 PE=4 SV=1
13	Q1XG44	5.0	34.3	2932	0.052	0.028	Q1XG44_XENLA Nipped-B protein OS=Xenopus laevis OX=8355 GN=nipbl.S PE=2 SV=1
14	Q9Z330	6.8	33.9	1622	0.035	0.034	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
15	Q95YM8	8.2	33.5	1598	0.025	0.025	MBLK1_APIME Mushroom body large-type Kenyon cell-specific protein 1 OS=Apis mellifera OX=7460 GN=Mblk-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11262 Tho2	6.3e-99	342.5	Transcription factor/nuclear export subunit protein 2
2	PF11732 Thoc2	2.9e-30	115.5	Transcription- and export-related complex subunit
3	PF16134 THOC2_N	6.9e-86	300.9	THO complex subunit 2 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245838

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261600	0.999	THO complex subunit 1
2	9606.ENSP00000265097	0.999	THO complex subunit 3
3	9606.ENSP00000295899	0.999	THO complex subunit 7 homolog
4	9606.ENSP00000326531	0.999	THO complex subunit 6 homolog
5	9606.ENSP00000379475	0.999	Spliceosome RNA helicase DDX39B
6	9606.ENSP00000420306	0.999	THO complex subunit 5 homolog
7	9606.ENSP00000421592	0.999	THO complex subunit 4
8	9606.ENSP00000337632	0.997	SAP domain-containing ribonucleoprotein
9	9606.ENSP00000357679	0.990	Chromatin target of PRMT1 protein
10	9606.ENSP00000392025	0.989	Ubiquitin carboxyl-terminal hydrolase CYLD
11	9606.ENSP00000242776	0.986	ATP-dependent RNA helicase DDX39A
12	9606.ENSP00000364289	0.982	Nuclear cap-binding protein subunit 1
13	9606.ENSP00000397927	0.957	Polymerase delta-interacting protein 3
14	9606.ENSP00000436679	0.953	Nuclear RNA export factor 1
15	9606.ENSP00000390436	0.932	Zinc finger protein GLI2
16	9606.ENSP00000241502	0.918	UAP56-interacting factor
17	9606.ENSP00000380820	0.908	Germinal-center associated nuclear protein
18	9606.ENSP00000269349	0.889	Eukaryotic initiation factor 4A-III
19	9606.ENSP00000362820	0.886	Serine/arginine-rich splicing factor 3
20	9606.ENSP00000258962	0.879	Serine/arginine-rich splicing factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0003729	0.804	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0071704	0.929	organic substance metabolic process
GO:0048519	0.915	negative regulation of biological process
GO:0043170	0.882	macromolecule metabolic process
GO:0048523	0.857	negative regulation of cellular process
GO:0031344	0.857	regulation of cell projection organization
GO:0031345	0.832	negative regulation of cell projection organization
GO:0010467	0.771	gene expression
GO:0120035	0.695	regulation of plasma membrane bounded cell projection organization
GO:0051179	0.685	localization
GO:0010975	0.646	regulation of neuron projection development
GO:0015931	0.642	nucleobase-containing compound transport
GO:0044238	0.632	primary metabolic process
GO:0032502	0.631	developmental process
GO:0051169	0.608	nuclear transport
GO:0019222	0.589	regulation of metabolic process
GO:0060255	0.570	regulation of macromolecule metabolic process
GO:0006913	0.553	nucleocytoplasmic transport
GO:0050658	0.540	RNA transport
GO:0006807	0.537	nitrogen compound metabolic process
GO:0051168	0.531	nuclear export
GO:0010977	0.528	negative regulation of neuron projection development
GO:0032501	0.495	multicellular organismal process
GO:0006405	0.491	RNA export from nucleus
GO:0048856	0.464	anatomical structure development
GO:0051028	0.434	mRNA transport
GO:0010468	0.413	regulation of gene expression
GO:0044237	0.392	cellular metabolic process
GO:0034641	0.348	cellular nitrogen compound metabolic process
GO:0090304	0.341	nucleic acid metabolic process
GO:0006406	0.313	mRNA export from nucleus
GO:0016070	0.312	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0140513	0.994	nuclear protein-containing complex
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005694	0.869	chromosome
GO:0005737	0.787	cytoplasm
GO:0098687	0.721	chromosomal region
GO:0000347	0.651	THO complex
GO:0000781	0.501	chromosome, telomeric region
GO:0000445	0.442	THO complex part of transcription export complex
GO:0016020	0.310	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]