StarFunc result for job id Q8NI35

User Input

>input (1801 residues)
MPENPATDKLQVLQVLDRLKMKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQSIKQL
KGQLNHIPSDCSANFDFSRKGLLVFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDFN
SVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPET
VCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSL
FETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVA
VDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPPSDRGTVVEPLKPPALF
LTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYE
VMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQP
EDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETE
VDHNMDVNTEEDDDGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLV
ADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLVEDNEEE
SCYILHSSSNEDKTEFSGTIHDINSSLILEAPKGFRDEPYFKEELVDEPFLDLGKSFHSQ
QKEIEQSKEAWEMHEFLTPRLQEMDEEREILVDEEYELYQDPSPSMELYPLSHIQEATPV
PSVNELHFGTQWLHDNEPSESQEARTGRTVYSQEAQPYGYCPENVMKENFVMESLPSVPS
TEGNSQQGRFDDLENLNSLAKTSLDLGMIPNDVQGPSLLIDLPVVAQRREQEDLPLYQHQ
ATRVISKASAYTGMLSSRYATDTCELPEREEGEGEETPNFSHWGPPRIVEIFREPNVSLG
ISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSE
AVEAIKNAGNPVVFIVQSLSSTPRVIPNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMK
LPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRS
RMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIR
NEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQM
KQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEI
SKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEE
AITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFIS
DIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSWT
SARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEIN
RELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSH
ADVVNLLKNAYGRIILQVVADTNISAIAAQLENMSTGYHLGSPTAEHHPEDTEEQLQMTA
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E2QYC9	0.203	0.201	0.000	1828	0.884	0.871	E2QYC9.pdb.gz	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
2	AFDB:F1MAD2	0.264	0.260	0.000	1836	0.805	0.790	F1MAD2.pdb.gz	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
3	AFDB:Q8NI35	1.000	1.000	0.000	1801	1.000	1.000	Q8NI35.pdb.gz	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
4	AFDB:Q7KRY7	0.074	0.072	6.563E-31	1851	0.119	0.116	Q7KRY7.pdb.gz	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
5	AFDB:Q9VKG8	0.075	0.071	8.273E-26	1916	0.139	0.131	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
6	AFDB:Q17353	0.062	0.075	1.199E-19	1379	0.105	0.138	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
7	PDB:2xkxA	0.068	0.129	1.594E-17	721	0.063	0.158	2xkxA.pdb.gz
8	AFDB:A0A2R8QMK9	0.059	0.062	6.798E-17	1689	0.129	0.137	A0A2R8QMK9.pdb.gz
9	AFDB:Q56VX4	0.063	0.089	4.650E-16	1124	0.089	0.143	Q56VX4.pdb.gz	Q56VX4_CAEEL Tight junction protein ZO-1 OS=Caenorhabditis elegans OX=6239 GN=zoo-1 PE=1 SV=2
10	AFDB:A0A0B4K6Y7	0.057	0.048	1.068E-15	2395	0.079	0.060	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
11	AFDB:P39447	0.073	0.075	1.512E-14	1745	0.135	0.139	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
12	PDB:7p70A	0.046	0.204	8.370E-7	407	0.018	0.081	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7pc3A	0.048	0.209	2.626E-6	405	0.022	0.099	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7p73A	0.045	0.190	4.415E-6	420	0.016	0.067	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:5n7dA	0.049	0.202	1.185E-5	423	0.014	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:6pcvA	0.046	0.095	1.796E-5	754	0.026	0.062	6pcvA.pdb.gz
17	PDB:7pcbA	0.046	0.190	2.722E-5	415	0.015	0.065	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqmA	0.046	0.191	3.916E-5	413	0.019	0.085	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7qqnC	0.046	0.193	5.349E-5	414	0.016	0.070	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:3pv2B	0.044	0.135	5.935E-5	388	0.017	0.080	3pv2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y549	0.0	3664	1882	0.996	0.953	A0A2R8Y549_HUMAN PATJ crumbs cell polarity complex component OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=1
2	A5PKX9	0.0	2380	1181	0.645	0.983	A5PKX9_HUMAN INADL protein OS=Homo sapiens OX=9606 GN=INADL PE=1 SV=1
3	E2QYC9	0.0	3164	1828	0.885	0.871	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
4	F1MAD2	0.0	2811	1836	0.808	0.792	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
5	O75970	0.0	692	2070	0.224	0.195	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
6	Q63ZW7	0.0	2801	1834	0.807	0.793	INADL_MOUSE InaD-like protein OS=Mus musculus OX=10090 GN=Patj PE=1 SV=2
7	Q8NI35	0.0	3684	1801	1.000	1.000	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
8	O55164	1.83e-162	548	2054	0.199	0.174	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
9	Q8VBX6	2.69e-160	542	2055	0.196	0.172	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
10	G5ECZ8	5.26e-71	267	2422	0.097	0.072	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
11	Q8N448	1.61e-47	185	690	0.073	0.190	LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens OX=9606 GN=LNX2 PE=1 SV=1
12	Q91XL2	1.43e-44	176	687	0.065	0.170	LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus OX=10090 GN=Lnx2 PE=1 SV=2
13	F1R5N4	4.73e-44	175	737	0.076	0.185	F1R5N4_DANRE Ligand of Numb protein X 2 OS=Danio rerio OX=7955 GN=lnx2 PE=4 SV=1
14	B6DRF5	4.72e-43	172	737	0.075	0.183	B6DRF5_DANRE Ligand of numb-protein X 2 OS=Danio rerio OX=7955 GN=lnx2 PE=2 SV=1
15	Q9NB04	6.11e-42	170	871	0.066	0.135	PATJ_DROME Patj homolog OS=Drosophila melanogaster OX=7227 GN=Patj PE=1 SV=2
16	A4VCF7	7.22e-38	155	678	0.063	0.168	A4VCF7_DANRE Ligand of numb-protein X 2b OS=Danio rerio OX=7955 GN=lnxL PE=1 SV=1
17	O70263	2.09e-37	154	728	0.054	0.135	LNX1_MOUSE E3 ubiquitin-protein ligase LNX OS=Mus musculus OX=10090 GN=Lnx1 PE=1 SV=1
18	Q8TBB1	2.69e-36	151	728	0.055	0.136	LNX1_HUMAN E3 ubiquitin-protein ligase LNX OS=Homo sapiens OX=9606 GN=LNX1 PE=1 SV=1
19	Q62696	8.94e-31	134	911	0.062	0.122	DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1
20	Q811D0	1.24e-30	134	905	0.062	0.124	DLG1_MOUSE Disks large homolog 1 OS=Mus musculus OX=10090 GN=Dlg1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	71	14.0	Family of unknown function (DUF6288)
2	PF09045 L27_2	1.4e-11	55.5	L27_2
3	PF16667 MPDZ_u10	11	18.3	Unstructured region 10 on multiple PDZ protein
4	PF00595 PDZ	3.5e-141	471.2	PDZ domain
5	PF13180 PDZ_2	1.4e-39	145.6	PDZ domain
6	PF17820 PDZ_6	1.4e-78	270.0	PDZ domain
7	PF02163 Peptidase_M50	7e-29	112.7	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261681	0.999	MAGUK p55 subfamily member 5
2	9606.ENSP00000361027	0.999	Angiomotin
3	9606.ENSP00000427772	0.982	Protein KIBRA
4	9606.ENSP00000387739	0.975	Angiomotin-like protein 1
5	9606.ENSP00000349204	0.970	Protein crumbs homolog 3
6	9606.ENSP00000424765	0.956	Angiomotin-like protein 2
7	9606.ENSP00000439625	0.952	Pleckstrin homology domain-containing family G member 5
8	9606.ENSP00000363921	0.918	Partitioning defective 3 homolog
9	9606.ENSP00000465419	0.918	Tight junction protein ZO-3
10	9606.ENSP00000352995	0.888	Rho guanine nucleotide exchange factor 18
11	9606.ENSP00000367762	0.884	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
12	9606.ENSP00000289968	0.883	Rho GTPase-activating protein 17
13	9606.ENSP00000356370	0.879	Protein crumbs homolog 1
14	9606.ENSP00000232165	0.855	Ubiquitin-protein ligase E3A
15	9606.ENSP00000219255	0.853	Partitioning defective 6 homolog alpha
16	9606.ENSP00000357005	0.837	Junctional adhesion molecule A
17	9606.ENSP00000478927	0.837	Transcriptional coactivator YAP1
18	9606.ENSP00000344666	0.813	Merlin
19	9606.ENSP00000362734	0.803	Protein crumbs homolog 2
20	9606.ENSP00000221459	0.773	Protein lin-7 homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0071840	0.919	cellular component organization or biogenesis
GO:0016043	0.887	cellular component organization
GO:0048518	0.836	positive regulation of biological process
GO:0006996	0.813	organelle organization
GO:0048522	0.809	positive regulation of cellular process
GO:0051128	0.641	regulation of cellular component organization
GO:0050896	0.585	response to stimulus
GO:0032501	0.422	multicellular organismal process
GO:0032502	0.386	developmental process
GO:0007010	0.385	cytoskeleton organization
GO:0048856	0.384	anatomical structure development
GO:0032879	0.381	regulation of localization
GO:0022607	0.375	cellular component assembly
GO:0051716	0.373	cellular response to stimulus
GO:0051239	0.360	regulation of multicellular organismal process
GO:0007154	0.354	cell communication
GO:0023052	0.345	signaling
GO:0034330	0.325	cell junction organization
GO:0007165	0.311	signal transduction
GO:0007163	0.303	establishment or maintenance of cell polarity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0016020	1.000	membrane
GO:0043229	0.997	intracellular organelle
GO:0005911	0.997	cell-cell junction
GO:0005829	0.996	cytosol
GO:0005886	0.993	plasma membrane
GO:0043227	0.988	membrane-bounded organelle
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005856	0.958	cytoskeleton
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0032991	0.926	protein-containing complex
GO:0005576	0.900	extracellular region
GO:0031982	0.879	vesicle
GO:0070160	0.869	tight junction
GO:0005813	0.868	centrosome
GO:0034451	0.841	centriolar satellite
GO:0065010	0.811	extracellular membrane-bounded organelle
GO:0005615	0.810	extracellular space
GO:0070062	0.796	extracellular exosome
GO:0043296	0.637	apical junction complex
GO:0005634	0.622	nucleus
GO:0005923	0.385	bicellular tight junction
GO:0045177	0.342	apical part of cell
GO:0012505	0.329	endomembrane system
GO:0098590	0.314	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]