StarFunc result for job id Q8NI38

User Input

>input (313 residues)
MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARG
LRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRS
VLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLST
QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNM
KAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQL
LKRSRVAPPGLSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NI38	1.000	1.000	3.760E-45	313	1.000	1.000	Q8NI38.pdb.gz	IKBD_HUMAN NF-kappa-B inhibitor delta OS=Homo sapiens OX=9606 GN=NFKBID PE=1 SV=1
2	AFDB:Q2TB02	0.901	0.863	1.442E-39	327	0.872	0.835	Q2TB02.pdb.gz	IKBD_MOUSE NF-kappa-B inhibitor delta OS=Mus musculus OX=10090 GN=Nfkbid PE=1 SV=2
3	AFDB:Q9EST8	0.829	0.364	2.418E-22	728	0.415	0.179	Q9EST8.pdb.gz	IKBZ_MOUSE NF-kappa-B inhibitor zeta OS=Mus musculus OX=10090 GN=Nfkbiz PE=1 SV=1
4	AFDB:Q9BYH8	0.830	0.370	5.072E-22	718	0.415	0.181	Q9BYH8.pdb.gz	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
5	AFDB:Q9Z2F6	0.700	0.495	1.587E-14	448	0.291	0.203	Q9Z2F6.pdb.gz	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
6	AFDB:E7FFI8	0.695	0.361	1.128E-13	619	0.294	0.149	E7FFI8.pdb.gz	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
7	AFDB:P20749	0.710	0.497	1.403E-13	454	0.284	0.196	P20749.pdb.gz	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
8	AFDB:Q00653	0.721	0.264	4.172E-13	900	0.307	0.107	Q00653.pdb.gz	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
9	AFDB:Q6P780	0.659	0.570	8.378E-13	365	0.288	0.247	Q6P780.pdb.gz	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
10	AFDB:A0A024RD24	0.672	0.430	1.042E-12	500	0.272	0.170	A0A024RD24.pdb.gz
11	PDB:8cs9A	0.460	0.212	3.674E-9	796	0.201	0.079	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.575	0.759	4.772E-9	229	0.217	0.297	2dvwA.pdb.gz
13	PDB:6v9hC	0.575	0.654	1.629E-7	270	0.195	0.226	6v9hC.pdb.gz
14	PDB:4oauC	0.460	0.242	1.939E-7	692	0.227	0.103	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:5vkqA	0.512	0.138	2.411E-7	1499	0.204	0.043	5vkqA.pdb.gz
16	PDB:6aunA	0.459	0.271	8.170E-7	618	0.195	0.099	6aunA.pdb.gz
17	PDB:6jd6B	0.410	0.617	1.273E-5	192	0.137	0.224	6jd6B.pdb.gz
18	PDB:1wg0A	0.559	0.694	2.055E-5	243	0.160	0.206	1wg0A.pdb.gz
19	PDB:6dmwA	0.511	0.276	2.343E-5	631	0.173	0.086	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.
20	PDB:6pqpA	0.485	0.257	4.312E-5	615	0.147	0.075	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2TB02	0.0	543	327	0.872	0.835	IKBD_MOUSE NF-kappa-B inhibitor delta OS=Mus musculus OX=10090 GN=Nfkbid PE=1 SV=2
2	Q8NI38	0.0	618	313	1.000	1.000	IKBD_HUMAN NF-kappa-B inhibitor delta OS=Homo sapiens OX=9606 GN=NFKBID PE=1 SV=1
3	Q9EST8	2.30e-60	206	728	0.422	0.181	IKBZ_MOUSE NF-kappa-B inhibitor zeta OS=Mus musculus OX=10090 GN=Nfkbiz PE=1 SV=1
4	Q9BYH8	8.51e-60	205	718	0.403	0.175	IKBZ_HUMAN NF-kappa-B inhibitor zeta OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
5	C9JZ23	1.11e-57	197	601	0.380	0.198	C9JZ23_HUMAN NFKB inhibitor zeta (Fragment) OS=Homo sapiens OX=9606 GN=NFKBIZ PE=1 SV=1
6	P20749	3.57e-23	101	454	0.259	0.178	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
7	H7C0A2	1.07e-22	97.8	308	0.259	0.263	H7C0A2_HUMAN BCL3 transcription coactivator (Fragment) OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=1
8	Q9Z2F6	1.95e-21	96.3	448	0.252	0.176	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
9	E7FFI8	5.02e-20	92.8	619	0.275	0.139	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1
10	A0A8I6G6F3	1.79e-19	91.3	902	0.284	0.099	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
11	Q9WTK5	3.53e-19	90.5	899	0.288	0.100	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
12	Q00653	7.16e-19	89.4	900	0.304	0.106	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
13	Q04861	1.19e-18	89.0	983	0.252	0.080	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
14	Q6P780	2.67e-17	83.6	365	0.278	0.238	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
15	A0A8I6ASQ1	3.74e-17	83.2	358	0.278	0.243	A0A8I6ASQ1_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=1 SV=1
16	O54910	7.47e-17	82.4	364	0.278	0.239	IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus OX=10090 GN=Nfkbie PE=1 SV=2
17	Q63369	6.10e-15	77.4	522	0.256	0.153	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2
18	Q0II00	9.39e-15	77.0	902	0.256	0.089	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
19	Q20KN0	1.47e-14	75.9	439	0.246	0.175	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
20	Q9FY48	1.94e-14	76.3	1625	0.211	0.041	KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana OX=3702 GN=KEG PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	7.4e-18	75.3	Ankyrin repeat
2	PF12796 Ank_2	2.9e-18	77.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.3e-15	66.0	Ankyrin repeat
4	PF13637 Ank_4	9.7e-15	66.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.5e-12	58.7	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295025	0.928	Proto-oncogene c-Rel
2	9606.ENSP00000221452	0.840	Transcription factor RelB
3	9606.ENSP00000312988	0.778	NF-kappa-B inhibitor beta
4	9606.ENSP00000384273	0.739	Transcription factor p65
5	9606.ENSP00000358983	0.732	Nuclear factor NF-kappa-B p100 subunit
6	9606.ENSP00000226574	0.728	Nuclear factor NF-kappa-B p105 subunit
7	9606.ENSP00000466989	0.686	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
8	9606.ENSP00000353732	0.683	CAP-Gly domain-containing linker protein 3
9	9606.ENSP00000414516	0.682	Protein SSXT
10	9606.ENSP00000301175	0.674	Hydroxyproline dehydrogenase
11	9606.ENSP00000265881	0.670	Oligoribonuclease, mitochondrial
12	9606.ENSP00000483825	0.644	NF-kappa-B essential modulator
13	9606.ENSP00000362179	0.632	Endoribonuclease ZC3H12A
14	9606.ENSP00000382071	0.632	Biotin--protein ligase
15	9606.ENSP00000359540	0.629	Protein CREG1
16	9606.ENSP00000361027	0.622	Angiomotin
17	9606.ENSP00000221859	0.576	DNA-directed RNA polymerase II subunit RPB9
18	9606.ENSP00000221891	0.547	Amyloid-like protein 1
19	9606.ENSP00000301159	0.547	Protein lin-37 homolog
20	9606.ENSP00000246533	0.528	Calpain small subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.981	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0050896	0.966	response to stimulus
GO:0048518	0.965	positive regulation of biological process
GO:0051090	0.871	regulation of DNA-binding transcription factor activity
GO:0051716	0.824	cellular response to stimulus
GO:0009966	0.800	regulation of signal transduction
GO:0048523	0.791	negative regulation of cellular process
GO:0002684	0.786	positive regulation of immune system process
GO:0051239	0.769	regulation of multicellular organismal process
GO:0007165	0.747	signal transduction
GO:0002376	0.736	immune system process
GO:0044092	0.710	negative regulation of molecular function
GO:0050776	0.707	regulation of immune response
GO:0051241	0.701	negative regulation of multicellular organismal process
GO:0048584	0.692	positive regulation of response to stimulus
GO:0002764	0.653	immune response-regulating signaling pathway
GO:0048522	0.651	positive regulation of cellular process
GO:0043433	0.641	negative regulation of DNA-binding transcription factor activity
GO:0032088	0.632	negative regulation of NF-kappaB transcription factor activity
GO:0050778	0.616	positive regulation of immune response
GO:0050793	0.612	regulation of developmental process
GO:0043122	0.589	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0022407	0.540	regulation of cell-cell adhesion
GO:0002757	0.538	immune response-activating signaling pathway
GO:0007166	0.535	cell surface receptor signaling pathway
GO:0010941	0.521	regulation of cell death
GO:1903037	0.504	regulation of leukocyte cell-cell adhesion
GO:0002683	0.503	negative regulation of immune system process
GO:0008152	0.492	metabolic process
GO:0045595	0.447	regulation of cell differentiation
GO:0071704	0.434	organic substance metabolic process
GO:0002694	0.413	regulation of leukocyte activation
GO:2000026	0.412	regulation of multicellular organismal development
GO:0032501	0.411	multicellular organismal process
GO:0051093	0.407	negative regulation of developmental process
GO:1903706	0.401	regulation of hemopoiesis
GO:0044238	0.397	primary metabolic process
GO:0010721	0.386	negative regulation of cell development
GO:0050863	0.377	regulation of T cell activation
GO:1902105	0.377	regulation of leukocyte differentiation
GO:0002695	0.375	negative regulation of leukocyte activation
GO:1903707	0.362	negative regulation of hemopoiesis
GO:0032502	0.361	developmental process
GO:0042981	0.358	regulation of apoptotic process
GO:0046634	0.339	regulation of alpha-beta T cell activation
GO:1903038	0.335	negative regulation of leukocyte cell-cell adhesion
GO:0045620	0.335	negative regulation of lymphocyte differentiation
GO:0048856	0.332	anatomical structure development
GO:0045580	0.326	regulation of T cell differentiation
GO:0010604	0.303	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.944	cytoplasm
GO:0070013	0.901	intracellular organelle lumen
GO:0031981	0.883	nuclear lumen
GO:0005829	0.863	cytosol
GO:0005654	0.795	nucleoplasm
GO:0016020	0.409	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]