StarFunc result for job id Q8NI51

User Input

>input (663 residues)
MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSV
LEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLL
WLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLI
KLEEEQEKNQLLAERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEK
AKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKTFRTVTLL
RNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRH
VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK
HGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTH
KNEKRFKCKHCSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDAN
FIPTVYKCSKCGKGFSRWINLHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQK
EAAKGWKEAANGDEAAAEEASTTKGEQFPGEMFPVACRETTARVKEEVDEGVTCEMLLNT
MDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NI51	1.000	1.000	0.000	663	1.000	1.000	Q8NI51.pdb.gz	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
2	AFDB:Q96MU6	0.226	0.207	1.655E-30	729	0.229	0.209	Q96MU6.pdb.gz	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
3	AFDB:Q9P0L1	0.256	0.228	1.574E-29	754	0.226	0.199	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
4	AFDB:Q62788	0.248	0.224	6.865E-28	744	0.199	0.177	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
5	AFDB:M9PFM9	0.213	0.208	8.333E-27	686	0.184	0.178	M9PFM9.pdb.gz	M9PFM9_DROME Crooked legs, isoform H OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
6	AFDB:Q5DTH6	0.249	0.253	5.502E-26	653	0.190	0.193	Q5DTH6.pdb.gz	Q5DTH6_MOUSE MKIAA4205 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
7	AFDB:A8DYD3	0.226	0.197	1.881E-24	770	0.192	0.165	A8DYD3.pdb.gz	A8DYD3_DROME Combgap, isoform F OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=1
8	AFDB:P20662	0.184	0.161	2.399E-24	777	0.216	0.184	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
9	AFDB:Q4VBD9	0.176	0.167	1.046E-22	706	0.193	0.181	Q4VBD9.pdb.gz	GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus OX=10090 GN=Gzf1 PE=1 SV=2
10	AFDB:Q95RQ8	0.250	0.244	4.510E-22	683	0.193	0.187	Q95RQ8.pdb.gz	PITA_DROME Zinc finger protein pita OS=Drosophila melanogaster OX=7227 GN=pita PE=1 SV=1
11	PDB:3w5kB	0.076	0.248	2.230E-4	110	0.054	0.327	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4fjcE	0.044	0.058	1.701E-1	434	0.045	0.069	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
13	PDB:7pt6I	0.061	0.103	2.942E-1	341	0.042	0.082	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
14	PDB:5dkaA	0.051	0.217	3.753E-1	96	0.024	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:7pmkQ	0.052	0.047	3.753E-1	766	0.044	0.038	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:6ydhA	0.035	0.212	4.505E-1	62	0.018	0.194	6ydhA.pdb.gz
17	PDB:6o9lQ	0.057	0.069	5.089E-1	430	0.080	0.123	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:7o4iW	0.053	0.091	5.089E-1	312	0.060	0.128	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:6hivCv	0.044	0.031	8.282E-1	1059	0.039	0.025	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:5apnp	0.032	0.164	9.355E-1	91	0.018	0.132	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2APF3	0.0	736	636	0.570	0.594	CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus OX=10090 GN=Ctcfl PE=1 SV=1
2	Q6JAA4	0.0	536	798	0.371	0.308	Q6JAA4_DANRE CCCTC-binding factor OS=Danio rerio OX=7955 GN=im:7152666 PE=1 SV=1
3	Q8NI51	0.0	1379	663	1.000	1.000	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
4	V9GY73	0.0	1164	627	0.843	0.892	V9GY73_HUMAN CCCTC-binding factor like OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=1
5	V9GYX4	0.0	724	404	0.532	0.874	V9GYX4_HUMAN CCCTC-binding factor like OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=1
6	Q61164	3.22e-179	529	736	0.368	0.332	CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus OX=10090 GN=Ctcf PE=1 SV=2
7	P49711	4.13e-179	528	727	0.368	0.336	CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
8	A0A2R8YFL0	4.19e-179	528	725	0.368	0.337	A0A2R8YFL0_HUMAN CCCTC-binding factor OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
9	Q9R1D1	4.80e-179	528	737	0.368	0.331	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
10	Q08705	6.29e-179	528	728	0.367	0.334	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
11	Q9VS55	5.58e-93	307	818	0.241	0.196	Q9VS55_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=2
12	Q8TA44	9.92e-92	304	818	0.240	0.194	Q8TA44_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=1
13	Q6ECI4	2.04e-60	217	717	0.201	0.185	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
14	Q6NX49	6.89e-59	213	715	0.198	0.183	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
15	Q9UJW8	7.18e-59	212	692	0.192	0.184	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
16	Q6ZN57	5.74e-57	202	461	0.189	0.271	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
17	P52742	2.22e-56	204	658	0.187	0.188	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
18	Q9NQZ8	1.23e-55	199	489	0.186	0.252	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
19	Q6PF04	1.56e-55	201	617	0.187	0.201	ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens OX=9606 GN=ZNF613 PE=1 SV=2
20	Q96JL9	1.61e-55	202	665	0.163	0.162	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.4e-27	105.7	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	1.6e-20	83.0	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	47	15.4	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	1.1e-39	144.3	Zinc-finger double domain
5	PF13909 zf-H2C2_5	6.4e-12	56.3	C2H2-type zinc-finger domain
6	PF09723 Zn-ribbon_8	44	15.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343103	0.962	Protein arginine N-methyltransferase 7
2	9606.ENSP00000297338	0.776	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000386414	0.727	Double-strand-break repair protein rad21-like protein 1
4	9606.ENSP00000348538	0.715	RNA-binding protein 38
5	9606.ENSP00000354720	0.707	Structural maintenance of chromosomes protein 3
6	9606.ENSP00000360054	0.672	Phosphatase and actin regulator 3
7	9606.ENSP00000232603	0.665	MORC family CW-type zinc finger protein 1
8	9606.ENSP00000282516	0.645	Nipped-B-like protein
9	9606.ENSP00000292907	0.642	Cytochrome c oxidase subunit 7A1, mitochondrial
10	9606.ENSP00000364635	0.623	Protein-arginine deiminase type-2
11	9606.ENSP00000391826	0.623	Insulin-like growth factor II
12	9606.ENSP00000382863	0.608	Chromodomain-helicase-DNA-binding protein 8
13	9606.ENSP00000359128	0.605	Nucleoplasmin-3
14	9606.ENSP00000380466	0.603	Mitochondrial ribosomal protein L23
15	9606.ENSP00000478035	0.603	Mitochondrial ribosomal protein L23
16	9606.ENSP00000328547	0.586	DNA (cytosine-5)-methyltransferase 3B
17	9606.ENSP00000409906	0.585	Inactive ubiquitin carboxyl-terminal hydrolase 53
18	9606.ENSP00000064571	0.577	Cerebellin-4
19	9606.ENSP00000344254	0.572	FXYD domain-containing ion transport regulator 5
20	9606.ENSP00000263093	0.560	Bile acyl-CoA synthetase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.995	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.985	cellular process
GO:2001141	0.976	regulation of RNA biosynthetic process
GO:0010468	0.964	regulation of gene expression
GO:1903506	0.939	regulation of nucleic acid-templated transcription
GO:0006355	0.902	regulation of DNA-templated transcription
GO:0048518	0.783	positive regulation of biological process
GO:0016043	0.718	cellular component organization
GO:0006325	0.697	chromatin organization
GO:0048522	0.692	positive regulation of cellular process
GO:0006357	0.686	regulation of transcription by RNA polymerase II
GO:0040029	0.679	epigenetic regulation of gene expression
GO:0010604	0.677	positive regulation of macromolecule metabolic process
GO:0051173	0.632	positive regulation of nitrogen compound metabolic process
GO:0031325	0.611	positive regulation of cellular metabolic process
GO:0051179	0.559	localization
GO:0045935	0.507	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.503	positive regulation of RNA biosynthetic process
GO:0045893	0.494	positive regulation of DNA-templated transcription
GO:0034502	0.483	protein localization to chromosome
GO:0045944	0.388	positive regulation of transcription by RNA polymerase II
GO:0048519	0.357	negative regulation of biological process
GO:0048523	0.354	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.986	cytoplasm
GO:0005829	0.977	cytosol
GO:0016604	0.835	nuclear body
GO:0043232	0.571	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]