StarFunc result for job id Q8NI60

User Input

>input (647 residues)
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAK
SIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8NI60	1.000	1.000	2.541E-96	647	1.000	1.000	Q8NI60.pdb.gz	COQ8A_HUMAN Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1
2	AFDB:Q60936	0.893	0.895	1.412E-86	645	0.869	0.871	Q60936.pdb.gz	COQ8A_MOUSE Atypical kinase COQ8A, mitochondrial OS=Mus musculus OX=10090 GN=Coq8a PE=1 SV=2
3	AFDB:M0R0L2	0.646	0.804	3.332E-52	518	0.436	0.544	M0R0L2.pdb.gz	M0R0L2_HUMAN Coenzyme Q8B OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
4	AFDB:Q18486	0.658	0.565	6.422E-46	755	0.379	0.325	Q18486.pdb.gz	COQ8_CAEEL Atypical kinase coq-8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-8 PE=3 SV=2
5	AFDB:Q92338	0.665	0.703	7.924E-43	610	0.348	0.369	Q92338.pdb.gz	ABCI_SCHPO Protein ABC1 homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc1 PE=2 SV=1
6	AFDB:P27697	0.597	0.756	1.544E-41	501	0.309	0.399	P27697.pdb.gz	COQ8_YEAST Atypical kinase COQ8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ8 PE=1 SV=1
7	AFDB:O53343	0.520	0.722	1.233E-20	447	0.175	0.253	O53343.pdb.gz	O53343_MYCTU Probable conserved ATP-binding protein ABC transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3197 PE=1 SV=1
8	AFDB:F4JFM1	0.516	0.469	7.447E-19	724	0.159	0.142	F4JFM1.pdb.gz	F4JFM1_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SIA1 PE=1 SV=1
9	AFDB:B9DGY1	0.503	0.472	1.583E-18	695	0.148	0.138	B9DGY1.pdb.gz	AB1K7_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K7 PE=1 SV=1
10	PDB:5yk1A	0.420	0.651	2.167E-18	401	0.150	0.242	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
11	AFDB:Q54P00	0.512	0.480	1.926E-17	695	0.130	0.121	Q54P00.pdb.gz	ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum OX=44689 GN=abkD PE=2 SV=1
12	PDB:6zxfz	0.247	0.402	7.041E-5	373	0.063	0.110	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	PDB:6g18v	0.206	0.377	1.183E-4	325	0.063	0.126	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
14	PDB:5oniA	0.202	0.350	1.645E-4	334	0.079	0.153	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
15	PDB:6zxdz	0.227	0.459	4.028E-4	292	0.074	0.164	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
16	PDB:6fail	0.197	0.398	1.084E-3	286	0.074	0.168	6fail.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
17	PDB:6kheA	0.193	0.328	1.136E-3	342	0.074	0.140	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
18	PDB:2yaaA	0.196	0.378	1.508E-3	300	0.077	0.167	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
19	PDB:2qkwB	0.182	0.366	1.581E-3	292	0.066	0.147	2qkwB.pdb.gz
20	PDB:4fi1A	0.185	0.293	1.737E-3	371	0.073	0.127	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3QJU3	0.0	665	624	0.539	0.559	COQ8B_DANRE Atypical kinase COQ8B, mitochondrial OS=Danio rerio OX=7955 GN=coq8b PE=3 SV=2
2	M0R0L2	0.0	570	518	0.439	0.548	M0R0L2_HUMAN Coenzyme Q8B OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
3	Q566J8	0.0	580	533	0.471	0.572	COQ8B_MOUSE Atypical kinase COQ8B, mitochondrial OS=Mus musculus OX=10090 GN=Coq8b PE=1 SV=1
4	Q60936	0.0	1145	645	0.869	0.871	COQ8A_MOUSE Atypical kinase COQ8A, mitochondrial OS=Mus musculus OX=10090 GN=Coq8a PE=1 SV=2
5	Q8NI60	0.0	1339	647	1.000	1.000	COQ8A_HUMAN Atypical kinase COQ8A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8A PE=1 SV=1
6	Q96D53	0.0	580	544	0.465	0.553	COQ8B_HUMAN Atypical kinase COQ8B, mitochondrial OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=2
7	Q18486	1.24e-161	484	755	0.360	0.309	COQ8_CAEEL Atypical kinase coq-8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-8 PE=3 SV=2
8	Q9SBB2	1.18e-136	415	623	0.323	0.335	ABC1_ARATH Protein ABC transporter 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABC1 PE=2 SV=1
9	Q92338	4.07e-130	398	610	0.314	0.333	ABCI_SCHPO Protein ABC1 homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc1 PE=2 SV=1
10	P27697	1.13e-124	380	501	0.297	0.383	COQ8_YEAST Atypical kinase COQ8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ8 PE=1 SV=1
11	Q389Y6	4.43e-111	347	564	0.295	0.339	Q389Y6_TRYB2 ABC1 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0390 PE=3 SV=1
12	M0R011	1.15e-56	193	230	0.198	0.557	M0R011_HUMAN Atypical kinase COQ8B, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
13	O53343	3.39e-31	129	447	0.172	0.248	O53343_MYCTU Probable conserved ATP-binding protein ABC transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3197 PE=1 SV=1
14	M0R3F7	3.55e-24	101	157	0.130	0.535	M0R3F7_HUMAN Coenzyme Q8B (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
15	Q9D0L4	4.39e-21	99.4	525	0.145	0.179	ADCK1_MOUSE AarF domain-containing protein kinase 1 OS=Mus musculus OX=10090 GN=Adck1 PE=1 SV=1
16	M0QZZ2	6.71e-20	89.0	149	0.119	0.517	M0QZZ2_HUMAN Atypical kinase COQ8B, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=COQ8B PE=1 SV=1
17	Q9LRN0	7.51e-20	96.7	793	0.131	0.107	Q9LRN0_ARATH AT3g24190/MUJ8_17 OS=Arabidopsis thaliana OX=3702 GN=At3g24190 PE=1 SV=1
18	Q86TW2	1.73e-19	94.7	530	0.139	0.170	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2
19	Q9MA15	6.71e-18	90.1	711	0.125	0.114	AB1K3_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K3 PE=1 SV=1
20	Q9W133	1.96e-17	88.2	518	0.131	0.164	ADCK_DROME AarF domain-containing kinase 1 OS=Drosophila melanogaster OX=7227 GN=Adck1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.5e-63	225.8	ABC1 atypical kinase-like domain
2	PF09490 CbtA	2.3e+02	13.0	Probable cobalt transporter subunit (CbtA)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355741

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288532	0.970	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
2	9606.ENSP00000333946	0.969	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
3	9606.ENSP00000262507	0.967	Ubiquinone biosynthesis protein COQ9, mitochondrial
4	9606.ENSP00000254759	0.956	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
5	9606.ENSP00000322316	0.954	5-demethoxyubiquinone hydroxylase, mitochondrial
6	9606.ENSP00000300452	0.941	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
7	9606.ENSP00000310873	0.941	4-hydroxybenzoate polyprenyltransferase, mitochondrial
8	9606.ENSP00000365388	0.941	Decaprenyl-diphosphate synthase subunit 1
9	9606.ENSP00000358033	0.899	Decaprenyl-diphosphate synthase subunit 2
10	9606.ENSP00000312587	0.780	Coenzyme Q-binding protein COQ10 homolog A, mitochondrial
11	9606.ENSP00000400806	0.751	Aprataxin
12	9606.ENSP00000426638	0.722	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
13	9606.ENSP00000263960	0.708	Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
14	9606.ENSP00000479919	0.684	Endophilin-B1
15	9606.ENSP00000072869	0.658	Uncharacterized aarF domain-containing protein kinase 2
16	9606.ENSP00000292246	0.658	Anoctamin-10
17	9606.ENSP00000354554	0.624	Cytochrome b
18	9606.ENSP00000318480	0.617	ATP-dependent zinc metalloprotease YME1L1
19	9606.ENSP00000355986	0.590	Synaptotagmin-14
20	9606.ENSP00000377311	0.585	Ferredoxin-2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016301	1.000	kinase activity
GO:0043531	1.000	ADP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006743	0.968	ubiquinone metabolic process
GO:0006744	0.960	ubiquinone biosynthetic process
GO:0006793	0.801	phosphorus metabolic process
GO:0016310	0.677	phosphorylation
GO:0071840	0.309	cellular component organization or biogenesis
GO:0044238	0.306	primary metabolic process
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.578	intracellular organelle lumen
GO:0016020	0.465	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	1.000	Transferring phosphorus-containing groups.

[back to server]