StarFunc result for job id Q8TAA5

User Input

>input (225 residues)
MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAER
ALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADIL
EKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHEL
ICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAA5	1.000	1.000	3.199E-39	225	1.000	1.000	Q8TAA5.pdb.gz	GRPE2_HUMAN GrpE protein homolog 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
2	AFDB:O88396	0.878	0.882	5.371E-33	224	0.849	0.853	O88396.pdb.gz	GRPE2_MOUSE GrpE protein homolog 2, mitochondrial OS=Mus musculus OX=10090 GN=Grpel2 PE=2 SV=2
3	AFDB:Q9HAV7	0.725	0.752	4.816E-20	217	0.404	0.419	Q9HAV7.pdb.gz	GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2
4	AFDB:P97576	0.687	0.712	1.857E-19	217	0.396	0.410	P97576.pdb.gz	GRPE1_RAT GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=2
5	AFDB:P48604	0.651	0.686	2.980E-17	213	0.342	0.362	P48604.pdb.gz	GRPE_DROME GrpE protein homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Roe1 PE=2 SV=2
6	AFDB:Q18421	0.651	0.620	1.603E-15	237	0.320	0.304	Q18421.pdb.gz	GRPE_CAEEL GrpE protein homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C34C12.8 PE=3 SV=1
7	AFDB:Q8LB47	0.680	0.474	3.049E-15	327	0.262	0.180	Q8LB47.pdb.gz	MGE2_ARATH GrpE protein homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge2 PE=1 SV=1
8	AFDB:Q9FLP3	0.692	0.521	4.483E-15	302	0.258	0.192	Q9FLP3.pdb.gz	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
9	AFDB:Q8IIB6	0.608	0.464	9.092E-15	301	0.249	0.186	Q8IIB6.pdb.gz	Q8IIB6_PLAF7 GrpE protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124700 PE=3 SV=2
10	AFDB:P38523	0.687	0.678	1.426E-14	228	0.236	0.232	P38523.pdb.gz	GRPE_YEAST GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGE1 PE=1 SV=1
11	PDB:1dkgA	0.615	0.852	1.225E-9	158	0.218	0.310	1dkgA.pdb.gz
12	PDB:2p22C	0.216	0.253	6.693E-1	186	0.107	0.129	2p22C.pdb.gz
13	PDB:5szhB	0.101	0.122	1.755	175	0.049	0.063	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:7cxrA	0.198	0.152	2.129	307	0.084	0.062	7cxrA.pdb.gz
15	PDB:1wleB	0.236	0.119	2.270	469	0.058	0.028	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
16	PDB:1u2mC	0.242	0.357	2.421	143	0.036	0.056	1u2mC.pdb.gz
17	PDB:6ylgb	0.173	0.071	2.421	613	0.076	0.028	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
18	PDB:7eo4B	0.098	0.135	2.581	151	0.058	0.086	7eo4B.pdb.gz	Structural basis of sphingosine-1-phosphate receptor 1 activation and biased agonism.
19	PDB:7ohyb	0.119	0.077	2.753	375	0.084	0.051	7ohyb.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
20	PDB:7s8tJ	0.207	0.475	2.753	83	0.036	0.096	7s8tJ.pdb.gz	Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAA5	5.04e-165	456	225	1.000	1.000	GRPE2_HUMAN GrpE protein homolog 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
2	O88396	2.34e-137	385	224	0.849	0.853	GRPE2_MOUSE GrpE protein homolog 2, mitochondrial OS=Mus musculus OX=10090 GN=Grpel2 PE=2 SV=2
3	D6RGI6	8.95e-72	216	128	0.467	0.820	D6RGI6_HUMAN GrpE like 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
4	Q9HAV7	6.99e-56	179	217	0.431	0.447	GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2
5	Q99LP6	2.51e-51	167	217	0.364	0.378	GRPE1_MOUSE GrpE protein homolog 1, mitochondrial OS=Mus musculus OX=10090 GN=Grpel1 PE=1 SV=1
6	P97576	6.73e-51	166	217	0.364	0.378	GRPE1_RAT GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=2
7	P48604	1.90e-34	124	213	0.293	0.310	GRPE_DROME GrpE protein homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Roe1 PE=2 SV=2
8	Q18421	5.64e-30	113	237	0.262	0.249	GRPE_CAEEL GrpE protein homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C34C12.8 PE=3 SV=1
9	Q8IIB6	4.11e-23	96.7	301	0.218	0.163	Q8IIB6_PLAF7 GrpE protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124700 PE=3 SV=2
10	P38523	1.71e-21	90.9	228	0.213	0.211	GRPE_YEAST GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGE1 PE=1 SV=1
11	Q9FLP3	2.97e-20	89.0	302	0.236	0.175	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
12	Q8LB47	4.20e-20	89.0	327	0.236	0.162	MGE2_ARATH GrpE protein homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge2 PE=1 SV=1
13	C4ZYN1	3.48e-15	73.2	197	0.222	0.254	GRPE_ECOBW Protein GrpE OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=grpE PE=1 SV=1
14	P09372	3.48e-15	73.2	197	0.222	0.254	GRPE_ECOLI Protein GrpE OS=Escherichia coli (strain K12) OX=83333 GN=grpE PE=1 SV=1
15	P28609	5.88e-14	69.7	187	0.213	0.257	GRPE_BORBU Protein GrpE OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=grpE PE=3 SV=1
16	Q97S73	5.43e-07	50.4	174	0.182	0.236	GRPE_STRPN Protein GrpE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=grpE PE=1 SV=1
17	P9WMT5	5.46e-05	45.1	235	0.200	0.191	GRPE_MYCTU Protein GrpE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=grpE PE=1 SV=1
18	Q9CGY9	0.003	39.3	179	0.160	0.201	GRPE_LACLA Protein GrpE OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=grpE PE=3 SV=1
19	A0A178U8H4	0.041	37.0	326	0.178	0.123	A0A178U8H4_ARATH GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17430 PE=1 SV=1
20	Q9XQC7	0.041	37.0	326	0.178	0.123	Q9XQC7_ARATH GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=EMB1241 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15070 GOLGA2L5	37	14.6	Putative golgin subfamily A member 2-like protein 5
2	PF01025 GrpE	5.1e-34	128.8	GrpE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329558

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270538	0.977	Mitochondrial import inner membrane translocase subunit TIM44
2	9606.ENSP00000297185	0.976	Stress-70 protein, mitochondrial
3	9606.ENSP00000264954	0.933	GrpE protein homolog 1, mitochondrial
4	9606.ENSP00000249269	0.929	Mitochondrial-processing peptidase subunit beta
5	9606.ENSP00000360782	0.913	Mitochondrial-processing peptidase subunit alpha
6	9606.ENSP00000315693	0.905	Mitochondrial import inner membrane translocase subunit TIM16
7	9606.ENSP00000372005	0.902	Mitochondrial import inner membrane translocase subunit TIM14
8	9606.ENSP00000368523	0.888	DnaJ homolog subfamily C member 15
9	9606.ENSP00000297534	0.862	Protein FMC1 homolog
10	9606.ENSP00000216027	0.853	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
11	9606.ENSP00000257245	0.852	Mitochondrial import inner membrane translocase subunit Tim10
12	9606.ENSP00000445806	0.837	Mitochondrial import inner membrane translocase subunit TIM50
13	9606.ENSP00000356256	0.826	Mitochondrial import inner membrane translocase subunit Tim17-A
14	9606.ENSP00000379999	0.826	Translocase of inner mitochondrial membrane 17B
15	9606.ENSP00000169551	0.786	Mitochondrial import inner membrane translocase subunit Tim21
16	9606.ENSP00000464522	0.778	Mitochondrial import inner membrane translocase subunit Tim23
17	9606.ENSP00000366482	0.772	Frataxin, mitochondrial
18	9606.ENSP00000460885	0.772	Belongs to the WD repeat coronin family.
19	9606.ENSP00000320434	0.769	Alpha-catulin
20	9606.ENSP00000481559	0.769	rRNA methyltransferase 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	0.999	unfolded protein binding
GO:0019899	0.343	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.966	cellular process
GO:0050896	0.867	response to stimulus
GO:0071840	0.556	cellular component organization or biogenesis
GO:0016043	0.519	cellular component organization
GO:0065007	0.490	biological regulation
GO:0050789	0.345	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.871	membrane
GO:0043233	0.673	organelle lumen
GO:0070013	0.662	intracellular organelle lumen
GO:0031090	0.635	organelle membrane
GO:0005740	0.624	mitochondrial envelope
GO:0019866	0.610	organelle inner membrane
GO:0005743	0.600	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]