StarFunc result for job id Q8TAB3

User Input

>input (1148 residues)
MESLLLPVLLLLAILWTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDPRQASA
FRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIK
DLNDNAPSFPAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKT
RGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSE
STYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTV
TGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSE
SAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYN
LTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDP
DLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGL
PSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGEN
GRVTYDMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLI
YLSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCSNCLT
ITCLLGCFIKGQNSKCLHCISVSPISEEQDKKTEEKVSLRGKRIAEYSYGHQKKSSKKKK
ISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNT
RNTSANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLE
GNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREE
CRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGK
DVSDHPAEERPTLKGKRTVDVTICSPKVNSVIREAGNGCEAISPVTSPLHLKSSLPTKPS
VSYTIALAPPARDLEQYVNNVNNGPTRPSEAEPRGADSEKVMHEVSPILKEGRNKESPGV
KRLKDIVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LG84	0.542	0.608	0.000	1017	0.618	0.697	A0A140LG84.pdb.gz
2	AFDB:A0A2R8QME5	0.588	0.616	0.000	1094	0.670	0.703	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
3	AFDB:C4P342	0.555	0.560	0.000	1137	0.466	0.471	C4P342.pdb.gz	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
4	AFDB:O14917	0.526	0.521	0.000	1159	0.475	0.470	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
5	AFDB:F1QRP2	0.548	0.554	7.205E-97	1135	0.354	0.358	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
6	AFDB:A0A2R8RMH2	0.553	0.552	5.303E-96	1150	0.352	0.351	A0A2R8RMH2.pdb.gz
7	AFDB:Q9HCL0	0.540	0.546	6.759E-95	1135	0.338	0.342	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
8	AFDB:Q9Y5I4	0.533	0.603	7.689E-92	1007	0.288	0.329	Q9Y5I4.pdb.gz	PCDC2_HUMAN Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2 PE=2 SV=1
9	AFDB:B5TR11	0.515	0.598	5.787E-87	979	0.267	0.314	B5TR11.pdb.gz	B5TR11_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 GN=PAPC PE=1 SV=1
10	AFDB:Q91Y17	0.539	0.646	3.135E-85	948	0.271	0.328	Q91Y17.pdb.gz	Q91Y17_MOUSE Protocadherin alpha 2 OS=Mus musculus OX=10090 GN=Pcdha2 PE=2 SV=1
11	PDB:7sqcO0	0.133	0.134	7.558E-14	1140	0.064	0.065	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.095	0.138	1.309E-13	721	0.072	0.115	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.150	0.727	1.119E-12	209	0.039	0.215	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5oj2B	0.117	0.171	9.500E-11	692	0.060	0.100	5oj2B.pdb.gz
15	PDB:6dldD	0.108	0.310	3.789E-8	269	0.039	0.167	6dldD.pdb.gz
16	PDB:4rtdA	0.068	0.069	1.136E-7	1122	0.072	0.074	4rtdA.pdb.gz
17	PDB:7q5zA	0.085	0.076	2.524E-7	1344	0.075	0.064	7q5zA.pdb.gz
18	PDB:6h03A	0.086	0.082	1.128E-6	1223	0.074	0.070	6h03A.pdb.gz
19	PDB:5a42A	0.075	0.058	1.247E-6	1597	0.078	0.056	5a42A.pdb.gz
20	PDB:4g1eA	0.094	0.103	4.796E-6	964	0.060	0.072	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QI99	711	997	0.367	0.422	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
2	A0A2R8QME5	1557	1094	0.674	0.707	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
3	A1L1W7	1557	1078	0.673	0.717	A1L1W7_DANRE Wu:fc83e05 protein (Fragment) OS=Danio rerio OX=7955 GN=wu:fc83e05 PE=2 SV=1
4	A9CPE6	622	1150	0.334	0.333	A9CPE6_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh 18 PE=2 SV=2
5	A9QUV5	640	1123	0.344	0.352	A9QUV5_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh18 PE=2 SV=1
6	C4P342	922	1137	0.469	0.473	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
7	E9PX28	709	1047	0.384	0.421	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
8	E9PXF0	950	1157	0.464	0.461	E9PXF0_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=1 SV=1
9	E9PXQ7	709	1057	0.384	0.417	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
10	F1QRP2	633	1135	0.347	0.351	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
11	F8W3X3	1555	1088	0.672	0.710	PCD19_DANRE Protocadherin-19 OS=Danio rerio OX=7955 GN=pcdh19 PE=1 SV=2
12	O14917	944	1159	0.470	0.465	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
13	Q3UTP0	796	755	0.361	0.550	Q3UTP0_MOUSE Cadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
14	Q5HZI5	949	1157	0.464	0.461	Q5HZI5_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
15	Q6NYV7	711	1001	0.367	0.421	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
16	Q6P0A6	653	896	0.307	0.393	Q6P0A6_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
17	Q805F0	697	1026	0.358	0.401	Q805F0_DANRE Protocadherin 10 OS=Danio rerio OX=7955 GN=pcdh10 PE=2 SV=1
18	Q80TE2	708	1098	0.384	0.402	Q80TE2_MOUSE MKIAA1400 protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
19	Q8VHR0	602	1134	0.330	0.334	PCD18_MOUSE Protocadherin 18 OS=Mus musculus OX=10090 GN=Pcdh18 PE=1 SV=2
20	Q925I8	710	1040	0.384	0.424	Q925I8_MOUSE OL-protocadherin isoform OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	2.8e-83	285.8	Cadherin domain
2	PF08266 Cadherin_2	4.8e-16	69.7	Cadherin-like
3	PF16184 Cadherin_3	0.086	24.2	Cadherin-like
4	PF17803 Cadherin_4	2.6e+02	13.6	Bacterial cadherin-like domain
5	PF16492 Cadherin_C_2	3.3e+02	13.4	Cadherin cytoplasmic C-terminal
6	PF03413 PepSY	29	16.6	Peptidase propeptide and YPEB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303540	0.810	Sodium channel protein type 1 subunit alpha
2	9606.ENSP00000369325	0.772	Cyclin-dependent kinase-like 5
3	9606.ENSP00000354251	0.756	Nck-associated protein 1
4	9606.ENSP00000368332	0.743	Homeobox protein ARX
5	9606.ENSP00000362399	0.728	Syntaxin-binding protein 1
6	9606.ENSP00000352035	0.718	Potassium voltage-gated channel subfamily KQT member 2
7	9606.ENSP00000342680	0.705	Uncharacterized protein CXorf67
8	9606.ENSP00000364586	0.702	Sodium channel protein type 2 subunit alpha
9	9606.ENSP00000410732	0.702	Gamma-aminobutyric acid receptor subunit gamma-2
10	9606.ENSP00000430497	0.681	Zinc finger homeobox protein 4
11	9606.ENSP00000361824	0.676	Spectrin alpha chain, non-erythrocytic 1
12	9606.ENSP00000259335	0.668	Proteasome-associated protein ECM29 homolog
13	9606.ENSP00000360822	0.666	Potassium channel subfamily T member 1
14	9606.ENSP00000377779	0.666	Synaptic vesicle glycoprotein 2B
15	9606.ENSP00000356790	0.660	Sodium/potassium-transporting ATPase subunit beta-1
16	9606.ENSP00000359829	0.656	Ubiquitin carboxyl-terminal hydrolase 33
17	9606.ENSP00000396915	0.653	Sodium channel subunit beta-1
18	9606.ENSP00000316377	0.648	Disks large-associated protein 1
19	9606.ENSP00000322020	0.644	Mitochondrial glutamate carrier 1
20	9606.ENSP00000384823	0.643	F-box only protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.947	ion binding
GO:0005509	0.938	calcium ion binding
GO:0042802	0.923	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0009987	0.980	cellular process
GO:0048856	0.960	anatomical structure development
GO:0007275	0.937	multicellular organism development
GO:0048731	0.856	system development
GO:0007399	0.726	nervous system development
GO:0065007	0.552	biological regulation
GO:0050789	0.500	regulation of biological process
GO:0050794	0.455	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.992	cell periphery
GO:0005886	0.976	plasma membrane
GO:0030054	0.351	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]