StarFunc result for job id Q8TAB5

User Input

>input (229 residues)
MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRS
SSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGGAGTVCSPLEDNGYASSSLSI
DSRSSSPEPACGTPRGPGPPDPLLPSVAQAVQHLQVQERYKEQEKEKHHVHLVMYRRLAL
LQWIRGLQHQLIDQQARLQESFDTILDNRKELIRCLQQRAAPSRPQDQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAB5	1.000	1.000	2.590E-33	229	1.000	1.000	Q8TAB5.pdb.gz	CA216_HUMAN UPF0500 protein C1orf216 OS=Homo sapiens OX=9606 GN=C1orf216 PE=1 SV=1
2	AFDB:Q9EPM5	0.242	0.130	7.185E-3	470	0.197	0.096	Q9EPM5.pdb.gz	SYNCI_MOUSE Syncoilin OS=Mus musculus OX=10090 GN=Sync PE=1 SV=1
3	AFDB:Q57VM8	0.368	0.160	1.462E-2	562	0.153	0.062	Q57VM8.pdb.gz	Q57VM8_TRYB2 PIH1D1/2/3 CS-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.460 PE=4 SV=1
4	AFDB:P33417	0.143	0.060	2.239E-2	597	0.218	0.084	P33417.pdb.gz	IXR1_YEAST Intrastrand cross-link recognition protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IXR1 PE=1 SV=2
5	AFDB:Q9SJN0	0.217	0.131	4.554E-2	442	0.175	0.090	Q9SJN0.pdb.gz	ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana OX=3702 GN=ABI5 PE=1 SV=1
6	AFDB:P17661	0.170	0.085	8.038E-2	470	0.166	0.081	P17661.pdb.gz	DESM_HUMAN Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3
7	AFDB:Q586A8	0.210	0.067	9.265E-2	797	0.153	0.044	Q586A8.pdb.gz	Q586A8_TRYB2 Trichohyalin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.200 PE=4 SV=1
8	AFDB:Q12315	0.245	0.120	9.947E-2	538	0.144	0.061	Q12315.pdb.gz	GLE1_YEAST mRNA export factor GLE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLE1 PE=1 SV=1
9	AFDB:Q6ZDF3	0.189	0.121	1.147E-1	374	0.170	0.104	Q6ZDF3.pdb.gz	TRAB1_ORYSJ bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica OX=39947 GN=TRAB1 PE=1 SV=2
10	AFDB:Q92351	0.212	0.043	1.147E-1	1208	0.170	0.032	Q92351.pdb.gz	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
11	PDB:5wlcST	0.167	0.085	5.241	599	0.087	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:6xywBv	0.147	0.211	8.026	149	0.105	0.161	6xywBv.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
13	PDB:5gm6P	0.129	0.122	8.617	246	0.092	0.085	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7d5sRN	0.205	0.093	8.617	607	0.070	0.026	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:6c95D	0.115	0.265	9.932	95	0.026	0.063	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAB5	2.13e-168	464	229	1.000	1.000	CA216_HUMAN UPF0500 protein C1orf216 OS=Homo sapiens OX=9606 GN=C1orf216 PE=1 SV=1
2	Q9V9W7	4.1	31.2	2089	0.070	0.008	Q9V9W7_DROME Rough deal OS=Drosophila melanogaster OX=7227 GN=rod PE=1 SV=2
3	F1M4Q6	5.1	30.8	3730	0.096	0.006	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
4	Q61329	5.9	30.8	3726	0.092	0.006	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
5	Q15911	6.4	30.4	3703	0.096	0.006	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
6	Q91YE9	7.4	30.0	573	0.100	0.040	5NT1B_MOUSE Cytosolic 5'-nucleotidase 1B OS=Mus musculus OX=10090 GN=Nt5c1b PE=1 SV=2
7	Q6AXN7	9.4	29.6	574	0.100	0.040	Q6AXN7_RAT 5'-nucleotidase, cytosolic IB OS=Rattus norvegicus OX=10116 GN=Nt5c1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15546 DUF4653	1.6e-115	396.7	Domain of unknown function (DUF4653)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425166

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260952	0.602	Asparagine synthetase domain containing 1
2	9606.ENSP00000484804	0.560	LisH domain-containing protein ARMC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.914	cellular process
GO:0019222	0.883	regulation of metabolic process
GO:0009889	0.854	regulation of biosynthetic process
GO:0031323	0.833	regulation of cellular metabolic process
GO:0060255	0.781	regulation of macromolecule metabolic process
GO:0080090	0.754	regulation of primary metabolic process
GO:0051171	0.751	regulation of nitrogen compound metabolic process
GO:0031326	0.750	regulation of cellular biosynthetic process
GO:0010556	0.736	regulation of macromolecule biosynthetic process
GO:0019219	0.729	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.727	positive regulation of biological process
GO:0048522	0.712	positive regulation of cellular process
GO:0051252	0.704	regulation of RNA metabolic process
GO:0010468	0.655	regulation of gene expression
GO:1903506	0.651	regulation of nucleic acid-templated transcription
GO:0032501	0.646	multicellular organismal process
GO:0006355	0.625	regulation of DNA-templated transcription
GO:0048519	0.472	negative regulation of biological process
GO:0071840	0.468	cellular component organization or biogenesis
GO:0016043	0.427	cellular component organization
GO:0006357	0.401	regulation of transcription by RNA polymerase II
GO:0050896	0.343	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.997	intracellular organelle
GO:0005737	0.996	cytoplasm
GO:0031981	0.987	nuclear lumen
GO:0005829	0.912	cytosol
GO:0043228	0.883	non-membrane-bounded organelle
GO:0043232	0.816	intracellular non-membrane-bounded organelle
GO:0005654	0.771	nucleoplasm
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]