StarFunc result for job id Q8TAC1

User Input

>input (157 residues)
MNLDGSAQDPEKREYSSVCVGREDDIKKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGDIEDFDGRPCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGIKQRIH
TVTVDNGNIYVTLSNEPFKCDSDFYATGDFKVIKSSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAC1	1.000	1.000	1.873E-31	157	1.000	1.000	Q8TAC1.pdb.gz	RFESD_HUMAN Rieske domain-containing protein OS=Homo sapiens OX=9606 GN=RFESD PE=1 SV=1
2	AFDB:Q57Z95	0.772	0.270	1.421E-14	467	0.408	0.137	Q57Z95.pdb.gz	Q57Z95_TRYB2 Rieske domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1250 PE=4 SV=1
3	AFDB:Q383Q4	0.673	0.517	1.289E-9	208	0.255	0.192	Q383Q4.pdb.gz	Q383Q4_TRYB2 Rieske domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2010 PE=4 SV=1
4	AFDB:H9N290	0.586	0.281	4.717E-7	355	0.146	0.065	H9N290.pdb.gz	NDMB_PSEPU Methylxanthine N3-demethylase NdmB OS=Pseudomonas putida OX=303 GN=ndmB PE=1 SV=1
5	PDB:4qdcA	0.565	0.258	8.712E-7	369	0.185	0.079	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
6	AFDB:Q9I2W2	0.511	0.714	1.359E-6	108	0.185	0.269	Q9I2W2.pdb.gz	Q9I2W2_PSEAE Assimilatory nitrite reductase small subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nirD PE=4 SV=1
7	PDB:6iclA	0.569	0.287	1.900E-6	338	0.146	0.068	6iclA.pdb.gz	Structural and Mechanistic Insights into Caffeine Degradation by the Bacterial N-Demethylase Complex.
8	AFDB:B6V6V5	0.574	0.256	2.371E-6	378	0.178	0.074	B6V6V5.pdb.gz	KSHA4_RHORH 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Rhodococcus rhodochrous OX=1829 GN=kshA PE=1 SV=1
9	AFDB:Q84BZ1	0.570	0.814	2.507E-6	108	0.172	0.250	Q84BZ1.pdb.gz	ANDAB_BURCE Anthranilate 1,2-dioxygenase ferredoxin subunit OS=Burkholderia cepacia OX=292 GN=andAb PE=1 SV=1
10	AFDB:H9N289	0.529	0.259	3.133E-6	351	0.166	0.074	H9N289.pdb.gz	NDMA_PSEPU Methylxanthine N1-demethylase NdmA OS=Pseudomonas putida OX=303 GN=ndmA PE=1 SV=1
11	AFDB:F1CMY8	0.575	0.250	4.891E-6	390	0.178	0.072	F1CMY8.pdb.gz	KSHA5_RHORH 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Rhodococcus rhodochrous OX=1829 GN=kshA PE=1 SV=1
12	PDB:4nbbE	0.537	0.725	6.837E-6	114	0.153	0.211	4nbbE.pdb.gz	Structural basis of the divergent oxygenation reactions catalyzed by the rieske nonheme iron oxygenase carbazole 1,9a-dioxygenase.
13	AFDB:P0ABW0	0.550	0.798	7.222E-6	106	0.153	0.226	P0ABW0.pdb.gz	HCAC_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit OS=Escherichia coli (strain K12) OX=83333 GN=hcaC PE=1 SV=1
14	PDB:2qpzA	0.556	0.827	8.543E-6	103	0.166	0.252	2qpzA.pdb.gz	Determining Rieske cluster reduction potentials.
15	PDB:6icnA	0.566	0.275	1.193E-5	344	0.153	0.070	6icnA.pdb.gz	Structural and Mechanistic Insights into Caffeine Degradation by the Bacterial N-Demethylase Complex.
16	PDB:2zylA	0.519	0.243	1.667E-5	359	0.159	0.070	2zylA.pdb.gz	Characterization of 3-ketosteroid 9{alpha}-hydroxylase, a Rieske oxygenase in the cholesterol degradation pathway of Mycobacterium tuberculosis
17	PDB:4aivA	0.576	0.785	1.970E-5	113	0.146	0.204	4aivA.pdb.gz
18	PDB:2jo6A	0.505	0.696	2.202E-5	110	0.159	0.227	2jo6A.pdb.gz
19	PDB:4qdfB	0.551	0.256	1.047E-4	357	0.146	0.064	4qdfB.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
20	PDB:1eg9A	0.489	0.199	1.237E-4	447	0.166	0.058	1eg9A.pdb.gz	Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAC1	3.10e-117	329	157	1.000	1.000	RFESD_HUMAN Rieske domain-containing protein OS=Homo sapiens OX=9606 GN=RFESD PE=1 SV=1
2	Q57Z95	3.94e-32	120	467	0.401	0.135	Q57Z95_TRYB2 Rieske domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1250 PE=4 SV=1
3	Q383Q4	8.42e-09	54.3	208	0.172	0.130	Q383Q4_TRYB2 Rieske domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2010 PE=4 SV=1
4	Q9I2W2	0.001	38.9	108	0.178	0.259	Q9I2W2_PSEAE Assimilatory nitrite reductase small subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nirD PE=4 SV=1
5	C9K029	0.004	38.9	596	0.115	0.030	C9K029_HUMAN Apoptosis inducing factor mitochondria associated 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=3
6	O52381	0.004	37.4	104	0.140	0.212	NAGAB_RALSP Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component OS=Ralstonia sp. OX=54061 GN=nagAb PE=1 SV=1
7	Q3TY86	0.004	38.9	605	0.115	0.030	AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus OX=10090 GN=Aifm3 PE=1 SV=1
8	Q96NN9	0.004	38.9	605	0.115	0.030	AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens OX=9606 GN=AIFM3 PE=1 SV=1
9	P0A185	0.030	34.7	104	0.134	0.202	NDOA_PSEPU Naphthalene 1,2-dioxygenase system, ferredoxin component OS=Pseudomonas putida OX=303 GN=ndoA PE=1 SV=2
10	B6V6V5	0.036	35.8	378	0.127	0.053	KSHA4_RHORH 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Rhodococcus rhodochrous OX=1829 GN=kshA PE=1 SV=1
11	F2Z4R3	0.037	36.2	599	0.140	0.037	F2Z4R3_DANRE Apoptosis-inducing factor 3 OS=Danio rerio OX=7955 GN=aifm3 PE=4 SV=1
12	P0ABW0	0.041	34.3	106	0.153	0.226	HCAC_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit OS=Escherichia coli (strain K12) OX=83333 GN=hcaC PE=1 SV=1
13	Q10499	0.045	35.8	611	0.127	0.033	AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aif1 PE=3 SV=3
14	Q61419	0.096	34.7	577	0.140	0.038	CMAH_MOUSE Cytidine monophosphate-N-acetylneuraminic acid hydroxylase OS=Mus musculus OX=10090 GN=Cmah PE=1 SV=1
15	Q9C9I7	0.12	34.3	287	0.178	0.098	Q9C9I7_ARATH Rieske (2Fe-2S) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=PSB33 PE=1 SV=1
16	F1CMY8	0.20	33.9	390	0.204	0.082	KSHA5_RHORH 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Rhodococcus rhodochrous OX=1829 GN=kshA PE=1 SV=1
17	Q84BZ1	0.24	32.3	108	0.134	0.194	ANDAB_BURCE Anthranilate 1,2-dioxygenase ferredoxin subunit OS=Burkholderia cepacia OX=292 GN=andAb PE=1 SV=1
18	A0R4R3	1.7	30.8	383	0.115	0.047	KSHA_MYCS2 3-ketosteroid-9-alpha-monooxygenase, oxygenase component OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=kshA PE=1 SV=1
19	C0HAD6	1.8	31.2	482	0.134	0.044	C0HAD6_SALSA Interferon regulatory factor 3 OS=Salmo salar OX=8030 GN=IRF3 PE=2 SV=1
20	Q1JUZ1	3.6	30.0	429	0.166	0.061	NVD_DROME Cholesterol 7-desaturase nvd OS=Drosophila melanogaster OX=7227 GN=nvd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07325 Curto_V2	21	16.4	Curtovirus V2 protein
2	PF00355 Rieske	4.6e-07	41.0	Rieske [2Fe-2S] domain
3	PF13806 Rieske_2	2.7e-06	38.6	Rieske-like [2Fe-2S] domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008974593.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003809437.1	0.787	Belongs to the globin family. ProRule:PRU00238, ECO:0000256\|RuleBase:RU000356,
2	9597.XP_003829836.1	0.696	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
3	9597.XP_003822409.1	0.693	Ankyrin repeat and SOCS box containing 6
4	9597.XP_008953419.1	0.692	Ubiquitin-associated protein 1 isoform X1
5	9597.XP_008970504.1	0.664	E3 ubiquitin-protein ligase RNF123
6	9597.XP_008973934.1	0.664	DnaJ heat shock protein family (Hsp40) member C11
7	9597.XP_003824666.1	0.663	Basic leucine zipper nuclear factor 1
8	9597.XP_008973988.1	0.661	THAP domain-containing protein 3
9	9597.XP_008972016.1	0.638	Tetraspanin 9
10	9597.XP_008976531.1	0.623	Coiled-coil domain containing 181
11	9597.XP_003822808.1	0.592	Spermatogenesis-associated protein 9 isoform X1
12	9597.XP_003821960.1	0.591	Translocase of outer mitochondrial membrane 70
13	9597.XP_008959858.1	0.588	Family with sequence similarity 234 member A
14	9597.XP_003822804.1	0.561	Rho-related BTB domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.829	catalytic activity
GO:0016491	0.380	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.946	metabolic process
GO:0071704	0.908	organic substance metabolic process
GO:0044237	0.839	cellular metabolic process
GO:0044238	0.364	primary metabolic process
GO:0065007	0.336	biological regulation
GO:0006807	0.304	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.987	cytosol
GO:0043227	0.972	membrane-bounded organelle
GO:0032991	0.486	protein-containing complex
GO:0043229	0.480	intracellular organelle
GO:0070013	0.414	intracellular organelle lumen
GO:0043231	0.411	intracellular membrane-bounded organelle
GO:0005634	0.311	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.380	Oxidoreductases.

[back to server]