StarFunc result for job id Q8TAD2

User Input

>input (202 residues)
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQL
GPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCL
TGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSI
NSSIDKQGAKLLLGPNDAPAGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAD2	1.000	1.000	6.566E-39	202	1.000	1.000	Q8TAD2.pdb.gz	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
2	AFDB:Q5TKT1	0.725	0.692	3.358E-21	212	0.550	0.524	Q5TKT1.pdb.gz	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
3	AFDB:Q8K4C5	0.508	0.527	1.360E-11	194	0.317	0.330	Q8K4C5.pdb.gz	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
4	AFDB:Q9UHF5	0.513	0.572	4.495E-11	180	0.243	0.272	Q9UHF5.pdb.gz	IL17B_HUMAN Interleukin-17B OS=Homo sapiens OX=9606 GN=IL17B PE=2 SV=1
5	AFDB:Q9P0M4	0.552	0.564	1.038E-10	197	0.248	0.254	Q9P0M4.pdb.gz	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
6	AFDB:Q9QXT6	0.493	0.549	1.675E-10	180	0.243	0.272	Q9QXT6.pdb.gz	IL17B_MOUSE Interleukin-17B OS=Mus musculus OX=10090 GN=Il17b PE=2 SV=1
7	AFDB:Q96PD4	0.390	0.476	7.467E-10	163	0.188	0.233	Q96PD4.pdb.gz	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
8	PDB:6hgoC	0.374	0.573	2.455E-9	127	0.163	0.260	6hgoC.pdb.gz
9	AFDB:Q16552	0.411	0.531	2.782E-9	155	0.183	0.239	Q16552.pdb.gz	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
10	AFDB:Q7TNI7	0.397	0.492	2.782E-9	161	0.198	0.248	Q7TNI7.pdb.gz	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
11	AFDB:D3ZLB1	0.434	0.514	3.534E-9	169	0.213	0.254	D3ZLB1.pdb.gz	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
12	PDB:7uwmA	0.358	0.619	1.234E-8	109	0.163	0.303	7uwmA.pdb.gz
13	PDB:4qhuC	0.390	0.641	5.180E-8	119	0.158	0.269	4qhuC.pdb.gz
14	PDB:7uwnE	0.302	0.623	2.046E-5	93	0.139	0.301	7uwnE.pdb.gz
15	PDB:2k8pA	0.268	0.283	6.755E-3	189	0.153	0.164	2k8pA.pdb.gz
16	PDB:1wq8A	0.250	0.398	1.228E-2	100	0.089	0.180	1wq8A.pdb.gz
17	PDB:1m4uA	0.339	0.343	1.304E-2	199	0.168	0.171	1m4uA.pdb.gz
18	PDB:7ag0A	0.333	0.455	1.867E-2	140	0.153	0.221	7ag0A.pdb.gz
19	PDB:4efvB	0.204	0.330	4.181E-1	108	0.099	0.185	4efvB.pdb.gz
20	PDB:5hk5F	0.205	0.293	4.181E-1	129	0.050	0.078	5hk5F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAD2	3.50e-145	404	202	1.000	1.000	IL17D_HUMAN Interleukin-17D OS=Homo sapiens OX=9606 GN=IL17D PE=2 SV=1
2	Q5TKT1	1.02e-69	213	212	0.545	0.519	Q5TKT1_DANRE Interleukin 17_4 OS=Danio rerio OX=7955 GN=zgc:194303 PE=2 SV=1
3	Q9P0M4	4.72e-15	72.4	197	0.178	0.183	IL17C_HUMAN Interleukin-17C OS=Homo sapiens OX=9606 GN=IL17C PE=1 SV=1
4	Q9QXT6	5.60e-14	68.9	180	0.223	0.250	IL17B_MOUSE Interleukin-17B OS=Mus musculus OX=10090 GN=Il17b PE=2 SV=1
5	Q96PD4	1.44e-12	65.1	163	0.158	0.196	IL17F_HUMAN Interleukin-17F OS=Homo sapiens OX=9606 GN=IL17F PE=1 SV=3
6	Q7TNI7	8.80e-12	62.8	161	0.158	0.199	IL17F_MOUSE Interleukin-17F OS=Mus musculus OX=10090 GN=Il17f PE=1 SV=1
7	Q5TKT0	8.87e-12	62.8	162	0.168	0.210	Q5TKT0_DANRE Interleukin 17_5 OS=Danio rerio OX=7955 GN=f3 PE=2 SV=1
8	Q9UHF5	1.18e-11	62.8	180	0.178	0.200	IL17B_HUMAN Interleukin-17B OS=Homo sapiens OX=9606 GN=IL17B PE=2 SV=1
9	Q8K4C5	3.46e-11	62.0	194	0.183	0.191	IL17C_MOUSE Interleukin-17C OS=Mus musculus OX=10090 GN=Il17c PE=1 SV=1
10	Q5TKT2	4.01e-09	55.8	167	0.158	0.192	Q5TKT2_DANRE Interleukin 17_3 OS=Danio rerio OX=7955 GN=il17c PE=3 SV=1
11	Q16552	2.65e-08	53.1	155	0.153	0.200	IL17_HUMAN Interleukin-17A OS=Homo sapiens OX=9606 GN=IL17A PE=1 SV=1
12	D3ZLB1	5.96e-06	47.0	169	0.149	0.178	D3ZLB1_RAT Interleukin 25 OS=Rattus norvegicus OX=10116 GN=Il25 PE=3 SV=1
13	Q70I21	1.07e-05	45.8	146	0.129	0.178	Q70I21_ONCMY Interleukin 17 isoform A OS=Oncorhynchus mykiss OX=8022 GN=il-17A PE=2 SV=1
14	Q62386	1.44e-05	45.8	158	0.153	0.196	IL17_MOUSE Interleukin-17A OS=Mus musculus OX=10090 GN=Il17a PE=1 SV=1
15	Q61453	5.85e-05	43.9	150	0.134	0.180	IL17_RAT Interleukin-17A OS=Rattus norvegicus OX=10116 GN=Il17a PE=2 SV=1
16	Q8VHH8	7.22e-05	43.9	169	0.144	0.172	IL25_MOUSE Interleukin-25 OS=Mus musculus OX=10090 GN=Il25 PE=2 SV=1
17	Q9H293	1.47e-04	43.1	177	0.144	0.164	IL25_HUMAN Interleukin-25 OS=Homo sapiens OX=9606 GN=IL25 PE=1 SV=1
18	Q9M210	0.43	33.1	256	0.069	0.055	ERF35_ARATH Ethylene-responsive transcription factor ERF035 OS=Arabidopsis thaliana OX=3702 GN=ERF035 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06083 IL17	1.2e-24	97.8	Interleukin-17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328111	0.861	Interleukin-25
2	9606.ENSP00000263379	0.822	Interleukin-27 receptor subunit alpha
3	9606.ENSP00000343204	0.820	Tyrosine-protein kinase JAK1
4	9606.ENSP00000431885	0.820	Non-receptor tyrosine-protein kinase TYK2
5	9606.ENSP00000371067	0.819	Tyrosine-protein kinase JAK2
6	9606.ENSP00000288167	0.773	Interleukin-17 receptor B
7	9606.ENSP00000320936	0.772	Interleukin-17 receptor A
8	9606.ENSP00000357470	0.763	Interleukin-6 receptor subunit alpha
9	9606.ENSP00000373325	0.762	Interleukin-17 receptor E
10	9606.ENSP00000295981	0.757	Interleukin-17 receptor C
11	9606.ENSP00000321345	0.752	Interleukin-23 receptor
12	9606.ENSP00000270800	0.718	Interleukin-22 receptor subunit alpha-1
13	9606.ENSP00000314976	0.715	Interleukin-20 receptor subunit alpha
14	9606.ENSP00000296318	0.705	Interleukin-17 receptor D
15	9606.ENSP00000296980	0.702	Interleukin-22 receptor subunit alpha-2
16	9606.ENSP00000328133	0.695	Interleukin-20 receptor subunit beta
17	9606.ENSP00000470788	0.695	Interleukin-12 receptor subunit beta-1
18	9606.ENSP00000290200	0.693	Interleukin-10 receptor subunit beta
19	9606.ENSP00000363318	0.671	Cytokine receptor common subunit gamma
20	9606.ENSP00000262345	0.664	Interleukin-12 receptor subunit beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0001819	0.982	positive regulation of cytokine production
GO:0002682	0.960	regulation of immune system process
GO:0050793	0.940	regulation of developmental process
GO:0006952	0.889	defense response
GO:0009987	0.875	cellular process
GO:0048519	0.874	negative regulation of biological process
GO:0032675	0.866	regulation of interleukin-6 production
GO:1900015	0.858	regulation of cytokine production involved in inflammatory response
GO:0048523	0.846	negative regulation of cellular process
GO:0051241	0.828	negative regulation of multicellular organismal process
GO:0080090	0.826	regulation of primary metabolic process
GO:0032677	0.825	regulation of interleukin-8 production
GO:0051716	0.806	cellular response to stimulus
GO:0051171	0.781	regulation of nitrogen compound metabolic process
GO:0045595	0.771	regulation of cell differentiation
GO:0051173	0.674	positive regulation of nitrogen compound metabolic process
GO:0048522	0.669	positive regulation of cellular process
GO:0051247	0.617	positive regulation of protein metabolic process
GO:0023052	0.585	signaling
GO:0007154	0.560	cell communication
GO:0042221	0.515	response to chemical
GO:0007165	0.495	signal transduction
GO:2000026	0.436	regulation of multicellular organismal development
GO:0006954	0.434	inflammatory response
GO:0032755	0.413	positive regulation of interleukin-6 production
GO:0048583	0.404	regulation of response to stimulus
GO:1903706	0.391	regulation of hemopoiesis
GO:0009605	0.368	response to external stimulus
GO:0070887	0.368	cellular response to chemical stimulus
GO:0010033	0.351	response to organic substance
GO:0032757	0.337	positive regulation of interleukin-8 production
GO:0009607	0.323	response to biotic stimulus
GO:0002683	0.318	negative regulation of immune system process
GO:0044419	0.313	biological process involved in interspecies interaction between organisms
GO:0043207	0.313	response to external biotic stimulus
GO:0045596	0.305	negative regulation of cell differentiation
GO:0031323	0.304	regulation of cellular metabolic process
GO:0010721	0.302	negative regulation of cell development
GO:0071310	0.300	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.457	cell periphery
GO:0005886	0.434	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]