StarFunc result for job id Q8TAF3

User Input

>input (677 residues)
MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLG
TIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQKST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5k1aF	0.876	0.988	0.000	600	0.883	0.997	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
2	AFDB:A0A024R2L1	0.989	0.989	0.000	677	1.000	1.000	A0A024R2L1.pdb.gz	A0A024R2L1_HUMAN WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 PE=2 SV=1
3	AFDB:Q20059	0.863	0.855	2.384E-81	683	0.461	0.457	Q20059.pdb.gz	WDR48_CAEEL WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-48 PE=1 SV=2
4	AFDB:Q93ZS6	0.806	0.729	2.865E-65	753	0.381	0.343	Q93ZS6.pdb.gz	Q93ZS6_ARATH AT3g05090/T12H1_5 OS=Arabidopsis thaliana OX=3702 GN=LRS1 PE=1 SV=1
5	AFDB:Q09731	0.773	0.556	2.162E-48	962	0.307	0.216	Q09731.pdb.gz	BU107_SCHPO UBP9-binding protein bun107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bun107 PE=1 SV=1
6	AFDB:Q99247	0.672	0.428	6.103E-30	1116	0.241	0.146	Q99247.pdb.gz	DUF1_YEAST DUB-associated factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DUF1 PE=1 SV=1
7	AFDB:P43033	0.394	0.643	1.530E-24	410	0.112	0.185	P43033.pdb.gz	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
8	PDB:5mzhB	0.379	0.591	4.923E-24	415	0.123	0.200	5mzhB.pdb.gz
9	AFDB:Q7KNS3	0.394	0.639	6.236E-24	411	0.108	0.178	Q7KNS3.pdb.gz	LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster OX=7227 GN=Lis-1 PE=1 SV=2
10	AFDB:D3Z7A5	0.385	0.600	9.104E-24	415	0.118	0.193	D3Z7A5.pdb.gz	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
11	AFDB:Q57W14	0.392	0.611	1.650E-23	419	0.108	0.174	Q57W14.pdb.gz	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
12	AFDB:Q8K450	0.396	0.419	1.650E-23	639	0.097	0.103	Q8K450.pdb.gz	SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1
13	PDB:5nnzA	0.337	0.643	2.491E-23	335	0.114	0.230	5nnzA.pdb.gz
14	PDB:2h9lA	0.386	0.785	7.921E-22	321	0.103	0.218	2h9lA.pdb.gz
15	PDB:3dm0A	0.393	0.394	1.782E-21	675	0.102	0.102	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
16	PDB:1vyhC	0.390	0.825	3.059E-21	310	0.106	0.232	1vyhC.pdb.gz
17	PDB:5yzgs	0.395	0.699	3.229E-21	374	0.077	0.139	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7bt6x	0.357	0.485	4.009E-21	488	0.111	0.154	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:7mq8LO	0.294	0.238	4.976E-21	848	0.096	0.077	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5jcsq	0.349	0.468	1.061E-20	488	0.096	0.133	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R2L1	0.0	1413	677	1.000	1.000	A0A024R2L1_HUMAN WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 PE=2 SV=1
2	Q20059	0.0	566	683	0.459	0.455	WDR48_CAEEL WD repeat-containing protein 48 homolog OS=Caenorhabditis elegans OX=6239 GN=wdr-48 PE=1 SV=2
3	Q8BH57	0.0	1394	676	0.988	0.990	WDR48_MOUSE WD repeat-containing protein 48 OS=Mus musculus OX=10090 GN=Wdr48 PE=1 SV=1
4	Q8TAF3	0.0	1413	677	1.000	1.000	WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens OX=9606 GN=WDR48 PE=1 SV=1
5	Q93ZS6	1.01e-124	389	753	0.400	0.360	Q93ZS6_ARATH AT3g05090/T12H1_5 OS=Arabidopsis thaliana OX=3702 GN=LRS1 PE=1 SV=1
6	Q09731	3.29e-59	217	962	0.236	0.166	BU107_SCHPO UBP9-binding protein bun107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bun107 PE=1 SV=1
7	Q54KL5	1.20e-25	110	335	0.093	0.188	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
8	Q7ZTX2	3.64e-25	109	334	0.102	0.207	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
9	P61964	1.14e-24	107	334	0.102	0.207	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
10	P61965	1.14e-24	107	334	0.102	0.207	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
11	Q498M4	1.14e-24	107	334	0.102	0.207	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
12	Q803D2	2.04e-24	108	410	0.105	0.173	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
13	P63004	3.24e-24	107	410	0.103	0.171	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
14	P63005	3.24e-24	107	410	0.103	0.171	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
15	P43033	3.55e-24	107	410	0.103	0.171	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
16	P43034	3.55e-24	107	410	0.103	0.171	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
17	Q9NDC9	4.31e-24	107	404	0.100	0.168	LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans OX=6239 GN=lis-1 PE=1 SV=1
18	Q4V8C4	1.25e-23	104	328	0.100	0.207	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
19	Q7KNS3	1.28e-23	106	411	0.114	0.187	LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster OX=7227 GN=Lis-1 PE=1 SV=2
20	Q17963	1.94e-23	105	376	0.089	0.160	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00093	30.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF11816 DUF3337	5.9e-45	164.7	Domain of unknown function (DUF3337)
3	PF20426 NBCH_WD40	2.6e-07	41.4	Neurobeachin beta propeller domain
4	PF08801 Nucleoporin_N	12	16.2	Nup133 N terminal like
5	PF16207 RAWUL	61	15.6	RAWUL domain RING finger- and WD40-associated ubiquitin-like
6	PF00400 WD40	1.6e-25	100.0	WD domain, G-beta repeat
7	PF17005 WD40_like	56	14.5	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008584610.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008585903.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 17 Proteins, and 76% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008563485.1	0.997	Ubiquitin carboxyl-terminal hydrolase 1-like
3	482537.XP_008589539.1	0.997	Ubiquitin carboxyl-terminal hydrolase 1
4	482537.XP_008572055.1	0.992	Ubiquitin carboxyl-terminal hydrolase 46
5	482537.XP_008572057.1	0.992	Uncharacterized protein LOC103591397
6	482537.XP_008577111.1	0.976	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
7	482537.XP_008585304.1	0.942	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
8	482537.XP_008583741.1	0.926	ATPase family AAA domain-containing protein 5
9	482537.XP_008564947.1	0.921	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008576831.1	0.918	Dystrophia myotonica WD repeat-containing protein
11	482537.XP_008588476.1	0.917	E3 ubiquitin-protein ligase FANCL
12	482537.XP_008592459.1	0.917	E3 ubiquitin-protein ligase FANCL-like
13	482537.XP_008567051.1	0.875	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 89% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	482537.XP_008566928.1	0.874	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 6 Proteins, and 61% coverage of the annotated genomic feature by RNAseq alignments
15	482537.XP_008579254.1	0.870	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 23 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
16	482537.XP_008569023.1	0.862	polyubiquitin-B
17	482537.XP_008572510.1	0.862	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 106 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
18	482537.XP_008577062.1	0.860	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008588846.1	0.859	ubiquitin-60S ribosomal protein L40
20	482537.XP_008571408.1	0.858	Fanconi anemia group B protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.975	nucleic acid binding
GO:0003677	0.739	DNA binding
GO:0003697	0.326	single-stranded DNA binding
GO:0008047	0.306	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.992	cellular process
GO:0050896	0.986	response to stimulus
GO:0050789	0.985	regulation of biological process
GO:0051716	0.975	cellular response to stimulus
GO:0050794	0.973	regulation of cellular process
GO:0048522	0.947	positive regulation of cellular process
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0080090	0.940	regulation of primary metabolic process
GO:0071704	0.929	organic substance metabolic process
GO:0044238	0.927	primary metabolic process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0006807	0.911	nitrogen compound metabolic process
GO:0043170	0.888	macromolecule metabolic process
GO:0006950	0.866	response to stress
GO:0044237	0.848	cellular metabolic process
GO:0006974	0.843	cellular response to DNA damage stimulus
GO:0051052	0.789	regulation of DNA metabolic process
GO:0010604	0.707	positive regulation of macromolecule metabolic process
GO:0051173	0.692	positive regulation of nitrogen compound metabolic process
GO:0048583	0.688	regulation of response to stimulus
GO:2001020	0.625	regulation of response to DNA damage stimulus
GO:0051054	0.510	positive regulation of DNA metabolic process
GO:1901360	0.477	organic cyclic compound metabolic process
GO:0034641	0.477	cellular nitrogen compound metabolic process
GO:0044260	0.476	cellular macromolecule metabolic process
GO:0006282	0.472	regulation of DNA repair
GO:0000018	0.459	regulation of DNA recombination
GO:0090304	0.459	nucleic acid metabolic process
GO:0006281	0.430	DNA repair
GO:1901564	0.395	organonitrogen compound metabolic process
GO:0045739	0.361	positive regulation of DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005829	0.967	cytosol
GO:0032991	0.372	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]