StarFunc result for job id Q8TAF8

User Input

>input (219 residues)
MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVNTPQAG
YFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALGMFLIIGSIICFSLFFI
CNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFM
LAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGTEEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4KL25	0.961	0.961	5.451E-33	219	0.982	0.982	Q4KL25.pdb.gz	LHPL5_MOUSE LHFPL tetraspan subfamily member 5 protein OS=Mus musculus OX=10090 GN=Lhfpl5 PE=1 SV=1
2	AFDB:A0A2R8QN41	0.944	0.915	1.063E-27	226	0.689	0.668	A0A2R8QN41.pdb.gz
3	AFDB:B0UYJ1	0.943	0.934	1.118E-27	221	0.653	0.647	B0UYJ1.pdb.gz	B0UYJ1_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5 PE=4 SV=1
4	AFDB:Q86UP9	0.910	0.845	1.819E-25	236	0.639	0.593	Q86UP9.pdb.gz	LHPL3_HUMAN LHFPL tetraspan subfamily member 3 protein OS=Homo sapiens OX=9606 GN=LHFPL3 PE=1 SV=3
5	AFDB:Q5U4E0	0.916	0.813	4.907E-24	247	0.598	0.530	Q5U4E0.pdb.gz	LHPL4_MOUSE LHFPL tetraspan subfamily member 4 protein OS=Mus musculus OX=10090 GN=Lhfpl4 PE=1 SV=1
6	PDB:6c14B	0.692	0.912	9.232E-17	164	0.726	0.970	6c14B.pdb.gz
7	AFDB:Q9W068	0.858	0.717	1.464E-14	265	0.306	0.253	Q9W068.pdb.gz	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1
8	AFDB:Q86WI0	0.675	0.672	2.130E-10	220	0.196	0.195	Q86WI0.pdb.gz	LHPL1_HUMAN LHFPL tetraspan subfamily member 1 protein OS=Homo sapiens OX=9606 GN=LHFPL1 PE=1 SV=1
9	AFDB:Q6ZUX7	0.674	0.649	7.798E-10	228	0.196	0.189	Q6ZUX7.pdb.gz	LHPL2_HUMAN LHFPL tetraspan subfamily member 2 protein OS=Homo sapiens OX=9606 GN=LHFPL2 PE=1 SV=2
10	AFDB:Q8BGA2	0.656	0.647	8.512E-8	222	0.192	0.189	Q8BGA2.pdb.gz	LHPL2_MOUSE LHFPL tetraspan subfamily member 2 protein OS=Mus musculus OX=10090 GN=Lhfpl2 PE=1 SV=1
11	AFDB:Q8C784	0.630	0.809	1.207E-7	167	0.137	0.180	Q8C784.pdb.gz	MOSMO_MOUSE Modulator of smoothened protein OS=Mus musculus OX=10090 GN=Mosmo PE=2 SV=2
12	PDB:7ocaI	0.625	0.727	2.604E-6	185	0.137	0.162	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:5b2gC	0.535	0.351	5.238E-6	350	0.123	0.077	5b2gC.pdb.gz
14	PDB:7rz4A	0.628	0.156	7.067E-6	993	0.119	0.026	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:7rzaA	0.593	0.153	1.164E-5	981	0.128	0.029	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:5kbtA	0.565	0.150	1.422E-5	973	0.164	0.037	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
17	PDB:6ov2A	0.574	0.678	9.015E-5	182	0.110	0.132	6ov2A.pdb.gz
18	PDB:6jp5E	0.546	0.687	2.704E-4	169	0.114	0.148	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:5weoA	0.599	0.145	2.988E-4	988	0.160	0.035	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
20	PDB:6wxuB	0.444	0.368	3.141E-4	273	0.105	0.084	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAF8	1.65e-163	451	219	1.000	1.000	LHPL5_HUMAN LHFPL tetraspan subfamily member 5 protein OS=Homo sapiens OX=9606 GN=LHFPL5 PE=1 SV=1
2	Q4KL25	3.45e-161	445	219	0.982	0.982	LHPL5_MOUSE LHFPL tetraspan subfamily member 5 protein OS=Mus musculus OX=10090 GN=Lhfpl5 PE=1 SV=1
3	Q5PPI7	3.45e-161	445	219	0.982	0.982	LHPL5_RAT LHFPL tetraspan subfamily member 5 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl5 PE=2 SV=1
4	F1Q837	1.95e-121	345	219	0.699	0.699	F1Q837_DANRE LHFPL tetraspan subfamily member 5a OS=Danio rerio OX=7955 GN=lhfpl5a PE=4 SV=2
5	Q86UP9	5.89e-110	317	236	0.653	0.606	LHPL3_HUMAN LHFPL tetraspan subfamily member 3 protein OS=Homo sapiens OX=9606 GN=LHFPL3 PE=1 SV=3
6	B0UYJ1	5.11e-108	311	221	0.653	0.647	B0UYJ1_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5 PE=4 SV=1
7	A8KB64	5.28e-107	308	216	0.648	0.657	A8KB64_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5b PE=2 SV=1
8	Q7Z7J7	7.13e-100	291	247	0.612	0.543	LHPL4_HUMAN LHFPL tetraspan subfamily member 4 protein OS=Homo sapiens OX=9606 GN=LHFPL4 PE=1 SV=1
9	Q5U4E0	2.33e-99	290	247	0.607	0.538	LHPL4_MOUSE LHFPL tetraspan subfamily member 4 protein OS=Mus musculus OX=10090 GN=Lhfpl4 PE=1 SV=1
10	Q7TSY2	2.33e-99	290	247	0.607	0.538	LHPL4_RAT LHFPL tetraspan subfamily member 4 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl4 PE=1 SV=1
11	Q9W068	1.60e-40	141	265	0.301	0.249	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1
12	Q6ZUX7	1.39e-08	55.5	228	0.196	0.189	LHPL2_HUMAN LHFPL tetraspan subfamily member 2 protein OS=Homo sapiens OX=9606 GN=LHFPL2 PE=1 SV=2
13	Q86WI0	1.10e-05	47.0	220	0.205	0.205	LHPL1_HUMAN LHFPL tetraspan subfamily member 1 protein OS=Homo sapiens OX=9606 GN=LHFPL1 PE=1 SV=1
14	Q8BGA2	4.28e-05	45.4	222	0.224	0.221	LHPL2_MOUSE LHFPL tetraspan subfamily member 2 protein OS=Mus musculus OX=10090 GN=Lhfpl2 PE=1 SV=1
15	Q9P7B3	7.76e-04	42.4	881	0.174	0.043	YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC521.04c PE=1 SV=1
16	F1NVZ5	6.5	30.4	808	0.078	0.021	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	7.1	17.9	PMP-22/EMP/MP20/Claudin tight junction
2	PF15158 DUF4579	2.4e+02	13.0	Domain of unknown function (DUF4579)
3	PF10242 L_HMGIC_fpl	2.2e-61	218.8	Lipoma HMGIC fusion partner-like protein
4	PF00822 PMP22_Claudin	1	20.7	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006263

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003328	0.950	Protocadherin-related 15
2	60711.ENSCSAP00000012269	0.729	Uncharacterized protein
3	60711.ENSCSAP00000007071	0.701	Transmembrane channel-like 2
4	60711.ENSCSAP00000004455	0.694	Transmembrane channel-like 1
5	60711.ENSCSAP00000006223	0.673	Tubby like protein 1
6	60711.ENSCSAP00000012553	0.673	Clarin 2
7	60711.ENSCSAP00000007856	0.658	Clarin 1
8	60711.ENSCSAP00000015740	0.651	STT3A, subunit of the oligosaccharyltransferase complex (catalytic)
9	60711.ENSCSAP00000005293	0.648	Transglutaminase 7
10	60711.ENSCSAP00000013545	0.637	Piezo-type mechanosensitive ion channel component 2
11	60711.ENSCSAP00000011233	0.600	Transmembrane channel-like 3
12	60711.ENSCSAP00000018132	0.592	Uncharacterized protein
13	60711.ENSCSAP00000005721	0.588	Collagen, type XI, alpha 2
14	60711.ENSCSAP00000001143	0.533	Enolase family member 4
15	60711.ENSCSAP00000001195	0.530	Uncharacterized protein
16	60711.ENSCSAP00000006062	0.522	Chromosome 6 open reading frame 106
17	60711.ENSCSAP00000006961	0.509	Sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
18	60711.ENSCSAP00000016696	0.509	Complement component 8, alpha polypeptide
19	60711.ENSCSAP00000000542	0.508	Leucine rich transmembrane and O-methyltransferase domain containing
20	60711.ENSCSAP00000004686	0.504	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007423	0.991	sensory organ development
GO:0042490	0.991	mechanoreceptor differentiation
GO:0035315	0.990	hair cell differentiation
GO:0048666	0.978	neuron development
GO:0050954	0.968	sensory perception of mechanical stimulus
GO:0007605	0.950	sensory perception of sound
GO:0048839	0.872	inner ear development
GO:0050896	0.861	response to stimulus
GO:0071840	0.816	cellular component organization or biogenesis
GO:0016043	0.808	cellular component organization
GO:0060119	0.806	inner ear receptor cell development
GO:0060122	0.788	inner ear receptor cell stereocilium organization
GO:0009653	0.706	anatomical structure morphogenesis
GO:0050974	0.675	detection of mechanical stimulus involved in sensory perception
GO:0048667	0.531	cell morphogenesis involved in neuron differentiation
GO:0042471	0.408	ear morphogenesis
GO:0042472	0.398	inner ear morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043226	0.865	organelle
GO:0043227	0.526	membrane-bounded organelle
GO:0043229	0.339	intracellular organelle
GO:0030054	0.300	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]