StarFunc result for job id Q8TAI7

User Input

>input (183 residues)
MPLVRYRKVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVD
TAGQDEYSILPYSFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTRVPVVLVGNK
ADLSPEREVQAVEGKKLAESWGATFMESSARENQLTQGIFTKVIQEIARVENSYGQERRC
HLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAI7	1.000	1.000	3.843E-40	183	1.000	1.000	Q8TAI7.pdb.gz	REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens OX=9606 GN=RHEBL1 PE=1 SV=1
2	PDB:3oesA	0.841	0.979	5.834E-29	157	0.852	0.994	3oesA.pdb.gz	Crystal structure of the small GTPase RhebL1
3	AFDB:Q15382	0.955	0.950	2.003E-27	184	0.514	0.511	Q15382.pdb.gz	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1
4	AFDB:Q9VND8	0.903	0.908	1.197E-24	182	0.497	0.500	Q9VND8.pdb.gz	RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1
5	AFDB:Q5ANA9	0.899	0.894	2.931E-24	184	0.383	0.380	Q5ANA9.pdb.gz	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
6	AFDB:O94363	0.918	0.908	3.551E-24	185	0.437	0.432	O94363.pdb.gz	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
7	AFDB:Q550Q4	0.900	0.891	3.551E-24	185	0.393	0.389	Q550Q4.pdb.gz	RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum OX=44689 GN=rheb PE=3 SV=1
8	PDB:3t5gA	0.867	0.927	3.711E-24	171	0.492	0.526	3t5gA.pdb.gz	Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.
9	AFDB:E9R5S0	0.909	0.890	3.544E-22	187	0.426	0.417	E9R5S0.pdb.gz	E9R5S0_ASPFU Rheb small monomeric GTPase RhbA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G05480 PE=4 SV=1
10	AFDB:O17599	0.926	0.936	3.774E-21	181	0.393	0.398	O17599.pdb.gz	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
11	AFDB:P25378	0.878	0.772	6.704E-20	209	0.383	0.335	P25378.pdb.gz	RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RHB1 PE=1 SV=2
12	AFDB:P32252	0.874	0.814	7.146E-20	197	0.344	0.320	P32252.pdb.gz	RASB_DICDI Ras-like protein rasB OS=Dictyostelium discoideum OX=44689 GN=rasB PE=1 SV=1
13	PDB:6kykC	0.855	0.923	3.694E-19	169	0.333	0.361	6kykC.pdb.gz	Shank3 Binds to and Stabilizes the Active Form of Rap1 and HRas GTPases via Its NTD-ANK Tandem with Distinct Mechanisms.
14	PDB:6zizA	0.872	0.935	1.166E-17	170	0.301	0.324	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
15	PDB:1kaoA	0.853	0.932	3.687E-17	167	0.355	0.389	1kaoA.pdb.gz	Crystal structures of the small G protein Rap2A in complex with its substrate GTP, with GDP and with GTPgammaS.
16	PDB:7btaB	0.757	0.949	7.449E-17	145	0.404	0.510	7btaB.pdb.gz	Molecular basis for the functions of dominantly active Y35N and inactive D60K Rheb mutants in mTORC1 signaling.
17	PDB:6if2B	0.850	0.873	4.186E-16	178	0.257	0.264	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
18	PDB:2bovA	0.843	0.889	1.164E-15	173	0.295	0.312	2bovA.pdb.gz	Molecular Recognition of an Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme by Rala Gtpase
19	PDB:2f9mA	0.855	0.860	1.603E-15	182	0.262	0.264	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
20	PDB:6zqtA	0.850	0.897	1.709E-15	173	0.290	0.306	6zqtA.pdb.gz	Affinity maturation of the RLIP76 Ral binding domain to inform the design of stapled peptides targeting the Ral GTPases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAI7	2.75e-135	377	183	1.000	1.000	REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens OX=9606 GN=RHEBL1 PE=1 SV=1
2	Q921J2	1.81e-68	208	184	0.525	0.522	RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus OX=10090 GN=Rheb PE=1 SV=1
3	Q62639	2.69e-68	207	184	0.525	0.522	RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus OX=10116 GN=Rheb PE=1 SV=1
4	Q15382	5.29e-68	207	184	0.525	0.522	RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens OX=9606 GN=RHEB PE=1 SV=1
5	Q9VND8	7.54e-58	181	182	0.503	0.505	RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster OX=7227 GN=Rheb PE=1 SV=1
6	Q5ANA9	1.11e-49	160	184	0.399	0.397	Q5ANA9_CANAL GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHB1 PE=4 SV=1
7	O94363	7.27e-49	158	185	0.437	0.432	RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhb1 PE=3 SV=1
8	Q550Q4	9.34e-49	158	185	0.393	0.389	RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum OX=44689 GN=rheb PE=3 SV=1
9	E9R5S0	7.68e-44	145	187	0.426	0.417	E9R5S0_ASPFU Rheb small monomeric GTPase RhbA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G05480 PE=4 SV=1
10	P25378	4.11e-37	129	209	0.399	0.349	RHEB_YEAST Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RHB1 PE=1 SV=2
11	O17599	6.12e-36	125	181	0.339	0.343	O17599_CAEEL small monomeric GTPase OS=Caenorhabditis elegans OX=6239 GN=rap-2 PE=1 SV=2
12	P32253	2.18e-35	124	189	0.339	0.328	RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum OX=44689 GN=rasC PE=1 SV=1
13	Q96HU8	3.64e-35	124	199	0.328	0.302	DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens OX=9606 GN=DIRAS2 PE=1 SV=1
14	Q8BU31	5.17e-35	123	183	0.317	0.317	RAP2C_MOUSE Ras-related protein Rap-2c OS=Mus musculus OX=10090 GN=Rap2c PE=1 SV=1
15	Q9Y3L5	5.17e-35	123	183	0.317	0.317	RAP2C_HUMAN Ras-related protein Rap-2c OS=Homo sapiens OX=9606 GN=RAP2C PE=1 SV=1
16	Q55CB7	9.91e-35	123	216	0.339	0.287	RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum OX=44689 GN=rasY PE=3 SV=1
17	Q55CA9	1.15e-34	123	214	0.328	0.280	RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum OX=44689 GN=rasZ PE=3 SV=1
18	Q7ZX67	2.30e-34	121	183	0.311	0.311	Q7ZX67_XENLA small monomeric GTPase OS=Xenopus laevis OX=8355 GN=rap2a.S PE=1 SV=1
19	A0A0G2JTW1	2.89e-34	121	183	0.311	0.311	A0A0G2JTW1_RAT Ras-related protein Rap-2 OS=Rattus norvegicus OX=10116 GN=Rap2a PE=3 SV=1
20	Q80ZJ1	2.89e-34	121	183	0.311	0.311	RAP2A_MOUSE Ras-related protein Rap-2a OS=Mus musculus OX=10090 GN=Rap2a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	72	14.8	AAA domain
2	PF00025 Arf	0.00023	32.2	ADP-ribosylation factor family
3	PF02421 FeoB_N	75	14.3	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	0.61	21.1	Elongation factor Tu GTP binding domain
5	PF01926 MMR_HSR1	6.1	18.4	50S ribosome-binding GTPase
6	PF00071 Ras	8.7e-42	154.0	Ras family
7	PF08477 Roc	4.9e-16	70.4	Ras of Complex, Roc, domain of DAPkinase
8	PF03193 RsgA_GTPase	5.7	18.3	RsgA GTPase
9	PF09439 SRPRB	3	18.8	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329915	0.694	Proteasome assembly chaperone 1
2	9606.ENSP00000385727	0.653	Microtubule associated serine/threonine kinase family member 4
3	9606.ENSP00000269601	0.602	Thioredoxin-like protein 4A
4	9606.ENSP00000267102	0.588	Protein LMBR1L
5	9606.ENSP00000354558	0.560	Serine/threonine-protein kinase mTOR
6	9606.ENSP00000257863	0.550	Anti-Muellerian hormone type-2 receptor
7	9606.ENSP00000219476	0.548	Tuberin
8	9606.ENSP00000350681	0.523	ETS domain-containing protein Elk-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0035639	0.998	purine ribonucleoside triphosphate binding
GO:0032555	0.998	purine ribonucleotide binding
GO:0005525	0.993	GTP binding
GO:0003824	0.952	catalytic activity
GO:0003924	0.882	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0035556	0.985	intracellular signal transduction
GO:0031929	0.911	TOR signaling
GO:0051171	0.830	regulation of nitrogen compound metabolic process
GO:0080090	0.811	regulation of primary metabolic process
GO:0010468	0.810	regulation of gene expression
GO:0044093	0.789	positive regulation of molecular function
GO:0009889	0.787	regulation of biosynthetic process
GO:0031326	0.784	regulation of cellular biosynthetic process
GO:0010556	0.780	regulation of macromolecule biosynthetic process
GO:2001141	0.748	regulation of RNA biosynthetic process
GO:0051091	0.729	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.724	positive regulation of NF-kappaB transcription factor activity
GO:0048583	0.357	regulation of response to stimulus
GO:0048518	0.353	positive regulation of biological process
GO:0010646	0.338	regulation of cell communication
GO:0023051	0.335	regulation of signaling
GO:0009966	0.330	regulation of signal transduction
GO:0048519	0.324	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.968	intracellular organelle
GO:0043227	0.960	membrane-bounded organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0016020	0.880	membrane
GO:0012505	0.731	endomembrane system
GO:0005634	0.683	nucleus
GO:0005829	0.662	cytosol
GO:0071944	0.373	cell periphery
GO:0005886	0.359	plasma membrane
GO:0032991	0.300	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.882	GTP + H2O = GDP + H(+) + phosphate

[back to server]