StarFunc result for job id Q8TAK6

User Input

>input (271 residues)
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAG
PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAK6	1.000	1.000	4.596E-39	271	1.000	1.000	Q8TAK6.pdb.gz	OLIG1_HUMAN Oligodendrocyte transcription factor 1 OS=Homo sapiens OX=9606 GN=OLIG1 PE=1 SV=2
2	AFDB:A8WIQ7	0.317	0.360	1.261E-8	235	0.362	0.417	A8WIQ7.pdb.gz	A8WIQ7_DANRE Oligodendrocyte transcription factor 1 OS=Danio rerio OX=7955 GN=olig1 PE=4 SV=1
3	AFDB:G3V612	0.257	0.217	1.443E-6	323	0.376	0.316	G3V612.pdb.gz	G3V612_RAT Oligodendrocyte transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Olig2 PE=1 SV=1
4	AFDB:Q90XB3	0.268	0.245	7.330E-6	298	0.343	0.312	Q90XB3.pdb.gz	OLIG2_CHICK Oligodendrocyte transcription factor 2 OS=Gallus gallus OX=9031 GN=OLIG2 PE=2 SV=1
5	AFDB:Q8NDY6	0.296	0.351	8.981E-6	225	0.244	0.293	Q8NDY6.pdb.gz	BHE23_HUMAN Class E basic helix-loop-helix protein 23 OS=Homo sapiens OX=9606 GN=BHLHE23 PE=1 SV=1
6	AFDB:Q8C6A8	0.286	0.224	1.260E-5	355	0.277	0.211	Q8C6A8.pdb.gz	BHE22_MOUSE Class E basic helix-loop-helix protein 22 OS=Mus musculus OX=10090 GN=Bhlhe22 PE=1 SV=1
7	AFDB:F1R9F5	0.289	0.299	2.024E-5	261	0.273	0.284	F1R9F5.pdb.gz	F1R9F5_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=Beta3.1 PE=4 SV=1
8	AFDB:Q5K548	0.267	0.294	2.166E-5	244	0.284	0.316	Q5K548.pdb.gz	Q5K548_DANRE BHLH transcription factor 3 OS=Danio rerio OX=7955 GN=olig3 PE=2 SV=1
9	AFDB:Q6PFG8	0.279	0.277	2.318E-5	273	0.325	0.322	Q6PFG8.pdb.gz	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
10	AFDB:P70660	0.198	0.218	1.652E-4	244	0.269	0.299	P70660.pdb.gz	NGN1_MOUSE Neurogenin-1 OS=Mus musculus OX=10090 GN=Neurog1 PE=1 SV=1
11	PDB:4v6wCh	0.126	0.254	9.812E-1	123	0.052	0.114	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:6tuyA	0.125	0.059	1.805	667	0.074	0.030	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
13	PDB:7suk5	0.188	0.173	2.710	296	0.055	0.051	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
14	PDB:6lo8E	0.139	0.393	3.320	80	0.041	0.138	6lo8E.pdb.gz
15	PDB:4v60A	0.139	0.049	4.353	812	0.092	0.031	4v60A.pdb.gz
16	PDB:7ah91A	0.099	0.114	4.658	223	0.048	0.058	7ah91A.pdb.gz
17	PDB:5wlcNB	0.121	0.215	4.984	142	0.085	0.162	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
18	PDB:6lo8F	0.152	0.405	5.333	84	0.052	0.167	6lo8F.pdb.gz
19	PDB:7pubCI	0.131	0.093	5.707	427	0.059	0.037	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:4uslA	0.090	0.134	6.107	173	0.030	0.046	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAK6	0.0	525	271	1.000	1.000	OLIG1_HUMAN Oligodendrocyte transcription factor 1 OS=Homo sapiens OX=9606 GN=OLIG1 PE=1 SV=2
2	Q9JKN5	1.19e-131	375	260	0.860	0.896	OLIG1_MOUSE Oligodendrocyte transcription factor 1 OS=Mus musculus OX=10090 GN=Olig1 PE=1 SV=2
3	A8WIQ7	1.39e-38	137	235	0.362	0.417	A8WIQ7_DANRE Oligodendrocyte transcription factor 1 OS=Danio rerio OX=7955 GN=olig1 PE=4 SV=1
4	Q5QJR2	1.51e-38	137	235	0.362	0.417	Q5QJR2_DANRE Oligodendrocyte transcription factor 1 OS=Danio rerio OX=7955 GN=olig1 PE=4 SV=1
5	Q6PFG8	1.36e-24	101	273	0.199	0.198	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
6	Q7RTU3	1.39e-24	101	272	0.199	0.199	OLIG3_HUMAN Oligodendrocyte transcription factor 3 OS=Homo sapiens OX=9606 GN=OLIG3 PE=1 SV=2
7	Q5K548	5.07e-24	99.0	244	0.192	0.213	Q5K548_DANRE BHLH transcription factor 3 OS=Danio rerio OX=7955 GN=olig3 PE=2 SV=1
8	Q90XB3	8.80e-24	99.8	298	0.192	0.174	OLIG2_CHICK Oligodendrocyte transcription factor 2 OS=Gallus gallus OX=9031 GN=OLIG2 PE=2 SV=1
9	Q8QGI4	2.40e-23	97.8	273	0.181	0.179	Q8QGI4_DANRE BHLH transcription factor OS=Danio rerio OX=7955 GN=wu:fc64g09 PE=2 SV=1
10	Q13516	4.04e-23	98.2	323	0.192	0.161	OLIG2_HUMAN Oligodendrocyte transcription factor 2 OS=Homo sapiens OX=9606 GN=OLIG2 PE=1 SV=2
11	G3V612	5.00e-23	98.2	323	0.192	0.161	G3V612_RAT Oligodendrocyte transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Olig2 PE=1 SV=1
12	Q9EQW6	5.26e-23	97.8	323	0.192	0.161	OLIG2_MOUSE Oligodendrocyte transcription factor 2 OS=Mus musculus OX=10090 GN=Olig2 PE=1 SV=1
13	Q8NDY6	3.08e-18	83.2	225	0.210	0.253	BHE23_HUMAN Class E basic helix-loop-helix protein 23 OS=Homo sapiens OX=9606 GN=BHLHE23 PE=1 SV=1
14	Q7T301	3.98e-18	83.2	238	0.173	0.197	Q7T301_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=bhlhe22 PE=2 SV=1
15	F1R9F5	6.37e-18	83.2	261	0.173	0.180	F1R9F5_DANRE Basic helix-loop-helix family, member e22 OS=Danio rerio OX=7955 GN=Beta3.1 PE=4 SV=1
16	Q9VJC1	1.88e-17	81.3	232	0.166	0.194	Q9VJC1_DROME GH17679p OS=Drosophila melanogaster OX=7227 GN=Oli PE=2 SV=1
17	Q8BGW3	6.92e-17	79.3	223	0.177	0.215	BHE23_MOUSE Class E basic helix-loop-helix protein 23 OS=Mus musculus OX=10090 GN=Bhlhe23 PE=2 SV=1
18	Q8NFJ8	1.05e-16	81.3	381	0.162	0.115	BHE22_HUMAN Class E basic helix-loop-helix protein 22 OS=Homo sapiens OX=9606 GN=BHLHE22 PE=2 SV=1
19	Q8C6A8	5.69e-16	79.0	355	0.159	0.121	BHE22_MOUSE Class E basic helix-loop-helix protein 22 OS=Mus musculus OX=10090 GN=Bhlhe22 PE=1 SV=1
20	O45489	1.94e-12	64.3	101	0.140	0.376	HLH17_CAEEL Helix-loop-helix protein 17 OS=Caenorhabditis elegans OX=6239 GN=hlh-17 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	6.1e-09	47.0	Helix-loop-helix DNA-binding domain
2	PF13801 Metal_resist	2e+02	13.6	Heavy-metal resistance

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367972	0.982	DNA-binding protein inhibitor ID-4
2	9606.ENSP00000380093	0.937	Transcription factor SOX-10
3	9606.ENSP00000366347	0.826	Homeobox protein Nkx-2.2
4	9606.ENSP00000380958	0.777	Myelin basic protein
5	9606.ENSP00000234091	0.775	DNA-binding protein inhibitor ID-2
6	9606.ENSP00000468500	0.761	Glial fibrillary acidic protein
7	9606.ENSP00000278836	0.745	Myelin regulatory factor
8	9606.ENSP00000481006	0.725	Myelin proteolipid protein
9	9606.ENSP00000376048	0.713	Myelin-associated glycoprotein
10	9606.ENSP00000332973	0.701	Mothers against decapentaplegic homolog 3
11	9606.ENSP00000357581	0.682	Homeobox protein Nkx-6.2
12	9606.ENSP00000266744	0.672	Achaete-scute homolog 1
13	9606.ENSP00000331040	0.672	Oligodendrocyte transcription factor 2
14	9606.ENSP00000312506	0.656	Chondroitin sulfate proteoglycan 4
15	9606.ENSP00000254976	0.652	Synaptosomal-associated protein 25
16	9606.ENSP00000377470	0.645	2',3'-cyclic-nucleotide 3'-phosphodiesterase
17	9606.ENSP00000261304	0.641	Galactocerebrosidase
18	9606.ENSP00000257290	0.640	Platelet-derived growth factor receptor alpha
19	9606.ENSP00000293894	0.630	Transcription factor SOX-8
20	9606.ENSP00000300213	0.623	Cyclin-D1-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.729	DNA binding
GO:0003690	0.671	double-stranded DNA binding
GO:1990837	0.664	sequence-specific double-stranded DNA binding
GO:0003700	0.662	DNA-binding transcription factor activity
GO:0000976	0.398	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007399	0.994	nervous system development
GO:0009987	0.984	cellular process
GO:0007417	0.967	central nervous system development
GO:0030154	0.955	cell differentiation
GO:0065007	0.894	biological regulation
GO:0050789	0.878	regulation of biological process
GO:0050794	0.869	regulation of cellular process
GO:0048709	0.837	oligodendrocyte differentiation
GO:0021782	0.721	glial cell development
GO:0014003	0.693	oligodendrocyte development
GO:0019222	0.603	regulation of metabolic process
GO:0080090	0.548	regulation of primary metabolic process
GO:0048663	0.547	neuron fate commitment
GO:0060255	0.524	regulation of macromolecule metabolic process
GO:0051171	0.522	regulation of nitrogen compound metabolic process
GO:0031323	0.437	regulation of cellular metabolic process
GO:0010468	0.429	regulation of gene expression
GO:1903506	0.419	regulation of nucleic acid-templated transcription
GO:0006355	0.413	regulation of DNA-templated transcription
GO:0048518	0.376	positive regulation of biological process
GO:0048522	0.332	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.987	cytoplasm
GO:0070013	0.795	intracellular organelle lumen
GO:0005654	0.790	nucleoplasm
GO:0032991	0.328	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]