StarFunc result for job id Q8TAM1

User Input

>input (723 residues)
MLSSMAAAGSVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRLLEALHL
EHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLMCENIQTHGRHW
KNCSRWKFISQALLTFQTQILDGIMDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYFCG
RVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLV
LQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFWIMEKTKAIMKH
LHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIGLSPFVPPQAFSQC
EIPNTALVKFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQHEDALHGALKM
LRQLFKDLDLNYMTQTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDAL
EKTQTYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLTDYYEPL
LKNNSTAYSTRGNRIEISYENLQVTNITRKGSMLPVSCKLPNMGTSQSYLSSSMPAGCVL
PVGGNFEILLHYYLLNYAKKCHQSEETMVSMIIANALLGIPKVLYKSKTGKYSFPHTYIR
AVHALQTNQPLVSSQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSE
DEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAM1	1.000	1.000	0.000	723	1.000	1.000	Q8TAM1.pdb.gz	BBS10_HUMAN Bardet-Biedl syndrome 10 protein OS=Homo sapiens OX=9606 GN=BBS10 PE=1 SV=2
2	AFDB:A0A286Y9A6	0.647	0.816	1.051E-34	567	0.238	0.303	A0A286Y9A6.pdb.gz	A0A286Y9A6_DANRE Bardet-Biedl syndrome 10 OS=Danio rerio OX=7955 GN=si:dkey-30c15.16 PE=3 SV=1
3	PDB:7nvme	0.578	0.756	6.736E-23	540	0.133	0.178	7nvme.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
4	PDB:7nvmD	0.600	0.815	1.138E-22	520	0.123	0.171	7nvmD.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
5	PDB:6ks6b	0.592	0.806	1.378E-22	518	0.118	0.164	6ks6b.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
6	PDB:7nvmQ	0.596	0.784	2.220E-22	538	0.119	0.160	7nvmQ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
7	PDB:7nvnb	0.603	0.809	2.530E-21	527	0.123	0.169	7nvnb.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
8	PDB:7nvmg	0.579	0.762	3.533E-21	538	0.119	0.160	7nvmg.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
9	PDB:7nvnZ	0.580	0.771	5.427E-21	529	0.122	0.166	7nvnZ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
10	PDB:6ks6E	0.570	0.749	9.621E-21	536	0.138	0.187	6ks6E.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
11	PDB:6ks6Q	0.578	0.746	1.550E-20	548	0.116	0.153	6ks6Q.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
12	PDB:7nvmA	0.605	0.800	3.023E-20	536	0.129	0.174	7nvmA.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
13	AFDB:A0A2R8QAJ5	0.276	0.104	1.220E-8	2105	0.071	0.024	A0A2R8QAJ5.pdb.gz
14	AFDB:F1NW90	0.061	0.055	2.731	823	0.068	0.060	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
15	AFDB:Q54S40	0.047	0.035	3.152	1312	0.059	0.033	Q54S40.pdb.gz	GBPD_DICDI Cyclic GMP-binding protein D OS=Dictyostelium discoideum OX=44689 GN=gbpD PE=2 SV=1
16	AFDB:F7BN18	0.072	0.049	3.467	1128	0.080	0.051	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
17	AFDB:O43281	0.062	0.072	5.587	561	0.068	0.087	O43281.pdb.gz	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
18	AFDB:O60741	0.071	0.062	5.587	890	0.101	0.082	O60741.pdb.gz	HCN1_HUMAN Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3
19	AFDB:A0A068Q816	0.043	0.045	5.860	664	0.036	0.039	A0A068Q816.pdb.gz	A0A068Q816_CHICK Histidine decarboxylase OS=Gallus gallus OX=9031 GN=HDC PE=2 SV=1
20	AFDB:A0A3Q7HES4	0.082	0.096	5.860	579	0.075	0.093	A0A3Q7HES4.pdb.gz	MTB2_SOLLC Transcription factor MTB2 OS=Solanum lycopersicum OX=4081 GN=MTB2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAM1	0.0	1501	723	1.000	1.000	BBS10_HUMAN Bardet-Biedl syndrome 10 protein OS=Homo sapiens OX=9606 GN=BBS10 PE=1 SV=2
2	A0A286Y9A6	2.35e-55	201	567	0.189	0.242	A0A286Y9A6_DANRE Bardet-Biedl syndrome 10 OS=Danio rerio OX=7955 GN=si:dkey-30c15.16 PE=3 SV=1
3	A4QP63	5.34e-55	200	565	0.187	0.239	A4QP63_DANRE Bardet-Biedl syndrome 10 protein OS=Danio rerio OX=7955 GN=si:dkey-30c15.16 PE=2 SV=1
4	Q9UTM4	6.46e-14	77.4	546	0.127	0.168	TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct5 PE=3 SV=1
5	P80316	9.58e-09	60.8	541	0.116	0.155	TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus OX=10090 GN=Cct5 PE=1 SV=1
6	F1MWD3	1.27e-08	60.5	541	0.115	0.153	F1MWD3_BOVIN T-complex protein 1 subunit epsilon OS=Bos taurus OX=9913 GN=CCT5 PE=1 SV=3
7	P48643	1.75e-07	57.0	541	0.112	0.150	TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1
8	V9HW37	1.75e-07	57.0	541	0.112	0.150	V9HW37_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=HEL-S-69 PE=1 SV=1
9	P40413	2.19e-07	56.6	562	0.090	0.116	TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT5 PE=1 SV=3
10	P39078	2.35e-07	56.6	528	0.123	0.169	TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT4 PE=1 SV=2
11	O74341	7.40e-07	54.7	528	0.033	0.045	TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct3 PE=1 SV=1
12	Q6PH46	8.12e-07	54.7	533	0.127	0.173	Q6PH46_DANRE T-complex protein 1 subunit delta OS=Danio rerio OX=7955 GN=zgc:65789 PE=1 SV=1
13	Q877H2	8.17e-07	54.7	553	0.030	0.040	Q877H2_9CREN Chaperonin OS=Acidianus tengchongensis OX=146920 PE=1 SV=1
14	P47209	1.05e-06	54.3	542	0.107	0.142	TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans OX=6239 GN=cct-5 PE=2 SV=1
15	Q38CD4	1.48e-06	53.9	536	0.033	0.045	Q38CD4_TRYB2 T-complex protein 1 subunit delta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7050 PE=3 SV=1
16	Q877G8	2.90e-06	53.1	543	0.032	0.042	Q877G8_METMI Chaperonin OS=Methanococcus maripaludis OX=39152 PE=1 SV=1
17	Q6NVI6	3.62e-06	52.8	541	0.113	0.152	Q6NVI6_DANRE T-complex protein 1 subunit epsilon OS=Danio rerio OX=7955 GN=CCT5 PE=1 SV=1
18	P50999	6.46e-06	52.0	527	0.127	0.175	TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct4 PE=2 SV=2
19	P87153	1.29e-05	50.8	558	0.030	0.039	TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct7 PE=1 SV=1
20	Q10147	1.29e-05	50.8	527	0.108	0.148	TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cct2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00118 Cpn60_TCP1	2.6e-29	113.9	TCP-1/cpn60 chaperonin family
2	PF06335 DUF1054	5.3e+02	11.9	Protein of unknown function (DUF1054)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286788	0.999	T-complex protein 1 subunit theta
2	9606.ENSP00000295688	0.999	T-complex protein 1 subunit gamma
3	9606.ENSP00000299300	0.999	T-complex protein 1 subunit beta
4	9606.ENSP00000377958	0.999	T-complex protein 1 subunit delta
5	9606.ENSP00000258091	0.998	T-complex protein 1 subunit eta
6	9606.ENSP00000353048	0.998	T-complex protein 1 subunit theta-like 2
7	9606.ENSP00000438273	0.998	Bardet-Biedl syndrome 12 protein
8	9606.ENSP00000242067	0.996	Protein PTHB1
9	9606.ENSP00000264499	0.996	Bardet-Biedl syndrome 7 protein
10	9606.ENSP00000275603	0.996	T-complex protein 1 subunit zeta
11	9606.ENSP00000403077	0.996	Vitamin K epoxide reductase complex subunit 1 like 1
12	9606.ENSP00000246062	0.995	McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin
13	9606.ENSP00000245157	0.994	Bardet-Biedl syndrome 2 protein
14	9606.ENSP00000317469	0.994	Bardet-Biedl syndrome 1 protein
15	9606.ENSP00000295240	0.993	Bardet-Biedl syndrome 5 protein
16	9606.ENSP00000327191	0.993	T-complex protein 1 subunit zeta-2
17	9606.ENSP00000317334	0.987	T-complex protein 1 subunit alpha
18	9606.ENSP00000268057	0.981	Bardet-Biedl syndrome 4 protein
19	9606.ENSP00000482306	0.975	Tetratricopeptide repeat protein 8
20	9606.ENSP00000433157	0.966	BBSome interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070925	0.995	organelle assembly
GO:0030031	0.993	cell projection assembly
GO:0050789	0.987	regulation of biological process
GO:0044782	0.984	cilium organization
GO:0050794	0.983	regulation of cellular process
GO:0060249	0.975	anatomical structure homeostasis
GO:0043933	0.931	protein-containing complex organization
GO:0065003	0.916	protein-containing complex assembly
GO:0120031	0.825	plasma membrane bounded cell projection assembly
GO:0001894	0.557	tissue homeostasis
GO:0051128	0.452	regulation of cellular component organization
GO:0060271	0.364	cilium assembly
GO:0045494	0.355	photoreceptor cell maintenance
GO:0043254	0.352	regulation of protein-containing complex assembly
GO:1905515	0.307	non-motile cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.996	nucleus
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.962	cytosol
GO:0032991	0.779	protein-containing complex
GO:0070013	0.741	intracellular organelle lumen
GO:0140535	0.541	intracellular protein-containing complex
GO:0005832	0.489	chaperonin-containing T-complex
GO:0016020	0.385	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]