StarFunc result for job id Q8TAP4

User Input

>input (145 residues)
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL
ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL
KNNMILCQTDYEEGLMKEGYAPQVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A9ED84	0.923	0.923	1.781E-30	145	1.000	1.000	A9ED84.pdb.gz	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
2	AFDB:A9ED79	0.907	0.844	1.261E-26	156	0.890	0.827	A9ED79.pdb.gz	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
3	AFDB:Q8IQX7	0.764	0.314	9.174E-22	384	0.669	0.253	Q8IQX7.pdb.gz	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
4	AFDB:M9PHX4	0.794	0.319	3.570E-21	383	0.669	0.253	M9PHX4.pdb.gz	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
5	AFDB:P25791	0.816	0.754	2.245E-19	158	0.531	0.487	P25791.pdb.gz	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
6	AFDB:Q9PTJ3	0.821	0.753	2.726E-19	159	0.497	0.453	Q9PTJ3.pdb.gz	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
7	AFDB:P61968	0.787	0.697	8.191E-19	165	0.462	0.406	P61968.pdb.gz	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
8	AFDB:Q8AW92	0.811	0.696	1.061E-18	171	0.497	0.421	Q8AW92.pdb.gz	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
9	AFDB:Q8QG63	0.789	0.694	1.288E-18	167	0.462	0.401	Q8QG63.pdb.gz	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
10	PDB:4kfzB	0.460	0.452	1.078E-17	148	0.531	0.520	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
11	AFDB:Q9VL21	0.770	0.482	8.103E-17	241	0.393	0.237	Q9VL21.pdb.gz	Q9VL21_DROME LD11652p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5708 PE=1 SV=2
12	PDB:1b8tA	0.387	0.299	1.633E-4	192	0.193	0.146	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.336	0.566	1.247E-2	76	0.117	0.224	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4r8pL	0.172	0.109	3.607E-1	254	0.069	0.039	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:7a1gM	0.234	0.515	5.318E-1	53	0.062	0.170	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
16	PDB:5dkaA	0.161	0.231	7.349E-1	96	0.069	0.104	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:7od1A	0.174	0.073	7.349E-1	430	0.166	0.056	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:5xncB	0.121	0.055	1.316	354	0.041	0.017	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
19	PDB:6tdaL	0.164	0.049	1.818	596	0.131	0.032	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
20	PDB:6ft6u	0.182	0.177	1.940	150	0.041	0.040	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9ED84	9.46e-106	299	145	1.000	1.000	A9ED84_PIG LIM domain only 3 OS=Sus scrofa OX=9823 GN=LMO3 PE=1 SV=1
2	Q8TAP4	9.46e-106	299	145	1.000	1.000	LMO3_HUMAN LIM domain only protein 3 OS=Homo sapiens OX=9606 GN=LMO3 PE=1 SV=1
3	A9ED79	2.55e-94	271	156	0.897	0.833	A9ED79_PIG LIM domain only 1 OS=Sus scrofa OX=9823 GN=LMO1 PE=2 SV=1
4	Q924W9	8.42e-94	270	156	0.897	0.833	RBTN1_MOUSE Rhombotin-1 OS=Mus musculus OX=10090 GN=Lmo1 PE=2 SV=1
5	P25800	1.10e-93	269	156	0.897	0.833	RBTN1_HUMAN Rhombotin-1 OS=Homo sapiens OX=9606 GN=LMO1 PE=1 SV=1
6	P91608	7.60e-68	207	266	0.662	0.361	P91608_DROSP Dttg protein OS=Drosophila sp. OX=7242 GN=dttg PE=2 SV=1
7	M9PHX4	1.78e-67	210	383	0.662	0.251	M9PHX4_DROME Beadex, isoform F OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=2
8	O77284	2.17e-67	208	313	0.662	0.307	O77284_DROME Beadex, isoform A OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
9	Q8IQX7	8.97e-67	209	384	0.662	0.250	Q8IQX7_DROME Beadex, isoform B OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
10	M9PI02	4.21e-66	208	424	0.662	0.226	M9PI02_DROME Beadex, isoform D OS=Drosophila melanogaster OX=7227 GN=Bx PE=1 SV=1
11	Q8AW92	1.48e-50	160	171	0.490	0.415	LMO4A_XENLA LIM domain transcription factor LMO4-A OS=Xenopus laevis OX=8355 GN=lmo4-a PE=1 SV=1
12	P25801	1.94e-48	155	158	0.503	0.462	RBTN2_MOUSE Rhombotin-2 OS=Mus musculus OX=10090 GN=Lmo2 PE=1 SV=1
13	P25791	2.00e-48	155	158	0.503	0.462	RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens OX=9606 GN=LMO2 PE=1 SV=1
14	A0A2R8RLI6	2.40e-48	155	166	0.462	0.404	A0A2R8RLI6_DANRE LIM domain only 4a OS=Danio rerio OX=7955 GN=NH13 PE=1 SV=1
15	Q8QG63	3.11e-48	154	167	0.462	0.401	Q8QG63_DANRE LIM domain only 4 OS=Danio rerio OX=7955 GN=lmo4 PE=1 SV=1
16	Q90XH3	8.10e-48	153	158	0.497	0.456	RBTN2_XENLA Rhombotin-2 OS=Xenopus laevis OX=8355 GN=lmo2 PE=2 SV=1
17	Q9PTJ3	1.68e-47	152	159	0.490	0.447	RBTN2_DANRE Rhombotin-2 OS=Danio rerio OX=7955 GN=lmo2 PE=2 SV=1
18	P61968	2.99e-47	152	165	0.462	0.406	LMO4_HUMAN LIM domain transcription factor LMO4 OS=Homo sapiens OX=9606 GN=LMO4 PE=1 SV=1
19	P61969	2.99e-47	152	165	0.462	0.406	LMO4_MOUSE LIM domain transcription factor LMO4 OS=Mus musculus OX=10090 GN=Lmo4 PE=1 SV=1
20	Q1LWV4	5.19e-34	124	396	0.476	0.174	LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 GN=lhx9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	4.5e-27	105.4	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10160.XP_004626157.1

Rank	PPI partner	STRING score	Description
1	10160.XP_004624606.1	0.913	LIM domain-binding protein 2 isoform X1
2	10160.XP_004631519.1	0.913	LIM domain-binding protein 1
3	10160.XP_004625366.1	0.846	LIM/homeobox protein Lhx9 isoform X1
4	10160.XP_004630817.1	0.833	Transcription factor GATA-4
5	10160.XP_004635351.1	0.833	Trans-acting T-cell-specific transcription factor GATA-3 isoform X1
6	10160.XP_004646151.1	0.833	Endothelial transcription factor GATA-2 isoform X1
7	10160.XP_004641646.1	0.778	LIM/homeobox protein Lhx2 isoform X1
8	10160.XP_004639610.1	0.766	beta-1,3-N-acetylglucosaminyltransferase radical fringe
9	10160.XP_004629671.1	0.746	beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
10	10160.XP_004634646.1	0.746	beta-1,3-N-acetylglucosaminyltransferase manic fringe isoform X1
11	10160.XP_004637760.1	0.725	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins
12	10160.XP_004632874.1	0.721	ELAV-like protein 3 isoform X1
13	10160.XP_004639213.1	0.719	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins
14	10160.XP_004635797.1	0.712	Upstream in-frame stop codon
15	10160.XP_004642603.1	0.708	Single-stranded DNA-binding protein 3 isoform X1
16	10160.XP_004641026.1	0.688	Single-stranded DNA-binding protein 2
17	10160.XP_004640447.1	0.653	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 8 Proteins
18	10160.XP_004643491.1	0.653	LIM/homeobox protein Lhx4
19	10160.XP_004624875.1	0.650	Homeobox protein OTX2 isoform X1
20	10160.XP_004644318.1	0.632	Cone-rod homeobox protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.381	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0048522	0.990	positive regulation of cellular process
GO:0006357	0.975	regulation of transcription by RNA polymerase II
GO:0045893	0.971	positive regulation of DNA-templated transcription
GO:0045944	0.811	positive regulation of transcription by RNA polymerase II
GO:0032501	0.648	multicellular organismal process
GO:0048856	0.521	anatomical structure development
GO:0007275	0.395	multicellular organism development
GO:0009987	0.394	cellular process
GO:0048523	0.381	negative regulation of cellular process
GO:0050793	0.374	regulation of developmental process
GO:0048731	0.321	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043226	0.982	organelle
GO:0005634	0.974	nucleus
GO:0005737	0.939	cytoplasm
GO:0070013	0.840	intracellular organelle lumen
GO:0031981	0.831	nuclear lumen
GO:0005654	0.623	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]