StarFunc result for job id Q8TAQ2

User Input

>input (1214 residues)
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATRE
WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLA
YQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGG
AIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVE
SEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLE
IKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTA
GPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLG
LPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMA
NPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPT
APSPGTVTPVPPPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB22	0.260	0.260	0.000	1214	1.000	1.000	A0A024RB22.pdb.gz
2	AFDB:F8VXC8	0.237	0.232	0.000	1245	1.000	0.975	F8VXC8.pdb.gz	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
3	AFDB:Q92922	0.230	0.252	0.000	1105	0.563	0.618	Q92922.pdb.gz	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
4	AFDB:F1Q9K1	0.237	0.264	4.339E-102	1089	0.565	0.630	F1Q9K1.pdb.gz	F1Q9K1_DANRE SWI/SNF complex subunit SMARCC1 isoform X1 OS=Danio rerio OX=7955 GN=smarcc1a PE=1 SV=1
5	AFDB:A0A0B4JDA0	0.239	0.251	2.867E-82	1145	0.443	0.470	A0A0B4JDA0.pdb.gz	A0A0B4JDA0_DROME Moira, isoform B OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
6	PDB:6lthO	0.107	0.337	2.429E-34	325	0.265	0.991	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
7	PDB:6lthN	0.094	0.366	3.599E-23	261	0.213	0.992	6lthN.pdb.gz	Structure of nucleosome-bound human BAF complex.
8	PDB:7vdvW	0.107	0.401	1.736E-22	248	0.203	0.996	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
9	PDB:7vdvX	0.091	0.425	1.935E-22	252	0.207	0.996	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
10	AFDB:O13788	0.125	0.259	1.153E-20	527	0.144	0.332	O13788.pdb.gz	SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr1 PE=1 SV=1
11	AFDB:P32591	0.114	0.149	9.067E-20	825	0.129	0.189	P32591.pdb.gz	SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWI3 PE=1 SV=1
12	PDB:7c4jB	0.101	0.282	1.081E-18	395	0.096	0.294	7c4jB.pdb.gz
13	PDB:6k15H	0.120	0.352	9.547E-16	393	0.100	0.308	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	PDB:6k15D	0.095	0.364	7.110E-15	305	0.094	0.374	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
15	PDB:7egmE	0.082	0.233	2.554E-13	422	0.090	0.258	7egmE.pdb.gz
16	PDB:6tdaL	0.119	0.238	4.293E-12	596	0.091	0.185	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
17	AFDB:E7F640	0.046	0.058	2.171E-3	866	0.106	0.149	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
18	AFDB:A0A0G2JXC5	0.037	0.040	3.538E-3	1038	0.119	0.139	A0A0G2JXC5.pdb.gz	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
19	AFDB:Q9ULH7	0.032	0.035	3.943E-3	1088	0.110	0.122	Q9ULH7.pdb.gz	MRTFB_HUMAN Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3
20	PDB:2cjjA	0.043	0.679	4.219E-2	63	0.015	0.286	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JDA0	0.0	840	1145	0.405	0.430	A0A0B4JDA0_DROME Moira, isoform B OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
2	A0A0G2K9D6	0.0	1240	1083	0.552	0.619	A0A0G2K9D6_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
3	A0A8I5ZP90	0.0	1188	1045	0.534	0.620	A0A8I5ZP90_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
4	A0A8I6A5E1	0.0	2040	1247	0.934	0.909	A0A8I6A5E1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
5	A0A8I6AGR8	0.0	2056	1216	0.934	0.933	A0A8I6AGR8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
6	A0A8I6AMA8	0.0	1240	1102	0.550	0.606	A0A8I6AMA8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=4 SV=1
7	D3ZJU5	0.0	1238	1078	0.550	0.620	D3ZJU5_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
8	D4A510	0.0	1857	1108	0.822	0.901	D4A510_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=4
9	F8VXC8	0.0	2469	1245	1.000	0.975	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
10	P97496	0.0	1231	1104	0.543	0.597	SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus OX=10090 GN=Smarcc1 PE=1 SV=2
11	Q6PDG5	0.0	2401	1213	0.966	0.967	SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus OX=10090 GN=Smarcc2 PE=1 SV=2
12	Q7KPY3	0.0	794	1189	0.394	0.402	Q7KPY3_DROME Moira OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
13	Q8MSY3	0.0	661	1002	0.347	0.420	Q8MSY3_DROME LD06146p OS=Drosophila melanogaster OX=7227 GN=mor PE=2 SV=1
14	Q8TAQ2	0.0	2484	1214	1.000	1.000	SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
15	Q92922	0.0	1217	1105	0.557	0.612	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
16	Q9VF03	0.0	830	1209	0.408	0.409	Q9VF03_DROME Brahma associated protein 155 kDa OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=3
17	G5EF87	7.05e-133	427	789	0.188	0.289	G5EF87_CAEEL SWI/SNF complex subunit SMARCC2 OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1
18	H8ESF3	9.41e-133	427	792	0.188	0.288	H8ESF3_CAEEL SWI/SNF complex subunit SMARCC2 OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1
19	H8ESF4	7.15e-109	359	685	0.156	0.276	H8ESF4_CAEEL SANT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1
20	P32591	7.95e-64	235	825	0.105	0.155	SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWI3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16589 BRCT_2	1.8e+02	13.9	BRCT domain, a BRCA1 C-terminus domain
2	PF00385 Chromo	75	14.7	Chromo (CHRromatin Organisation MOdifier) domain
3	PF00249 Myb_DNA-binding	3e-09	48.2	Myb-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	0.00092	30.7	Myb-like DNA-binding domain
5	PF04433 SWIRM	3e-29	112.5	SWIRM domain
6	PF16495 SWIRM-assoc_1	3.3e-26	102.4	SWIRM-associated region 1
7	PF16496 SWIRM-assoc_2	3.3e-193	653.9	SWIRM-associated domain at the N-terminal
8	PF16498 SWIRM-assoc_3	9.6e-28	107.5	SWIRM-associated domain at the C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262188	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
2	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
3	9606.ENSP00000265773	0.999	Probable global transcription activator SNF2L2
4	9606.ENSP00000320485	0.999	AT-rich interactive domain-containing protein 1A
5	9606.ENSP00000323967	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
6	9606.ENSP00000378414	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
7	9606.ENSP00000392617	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
8	9606.ENSP00000395654	0.999	Transcription activator BRG1
9	9606.ENSP00000397552	0.999	Actin-like protein 6A
10	9606.ENSP00000344546	0.998	AT-rich interactive domain-containing protein 1B
11	9606.ENSP00000378307	0.998	Protein polybromo-1
12	9606.ENSP00000436901	0.996	Zinc finger protein ubi-d4
13	9606.ENSP00000335044	0.995	AT-rich interactive domain-containing protein 2
14	9606.ENSP00000341805	0.994	PHD finger protein 10
15	9606.ENSP00000414516	0.994	Protein SSXT
16	9606.ENSP00000254480	0.990	SWI/SNF complex subunit SMARCC1
17	9606.ENSP00000349960	0.990	Actin, cytoplasmic 1
18	9606.ENSP00000419765	0.990	Bromodomain-containing protein 9
19	9606.ENSP00000479526	0.989	Zinc finger protein DPF3
20	9606.ENSP00000342434	0.984	Tyrosine-protein kinase BAZ1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.998	chromatin binding
GO:0003676	0.986	nucleic acid binding
GO:0003677	0.984	DNA binding
GO:0031490	0.890	chromatin DNA binding
GO:0031491	0.886	nucleosome binding
GO:0031492	0.884	nucleosomal DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.997	regulation of DNA-templated transcription
GO:0051172	0.996	negative regulation of nitrogen compound metabolic process
GO:0010605	0.996	negative regulation of macromolecule metabolic process
GO:0031324	0.996	negative regulation of cellular metabolic process
GO:1903507	0.988	negative regulation of nucleic acid-templated transcription
GO:0045892	0.984	negative regulation of DNA-templated transcription
GO:0009987	0.740	cellular process
GO:0048518	0.474	positive regulation of biological process
GO:0048522	0.410	positive regulation of cellular process
GO:0010604	0.398	positive regulation of macromolecule metabolic process
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0006357	0.363	regulation of transcription by RNA polymerase II
GO:0071704	0.346	organic substance metabolic process
GO:0031325	0.337	positive regulation of cellular metabolic process
GO:0045935	0.323	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0070603	0.995	SWI/SNF superfamily-type complex
GO:0016514	0.905	SWI/SNF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]