StarFunc result for job id Q8TAV0

User Input

>input (307 residues)
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQ
NVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVD
GKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMIL
EKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEK
SGAITSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TAV0	1.000	1.000	3.464E-53	307	1.000	1.000	Q8TAV0.pdb.gz	FA76A_HUMAN Protein FAM76A OS=Homo sapiens OX=9606 GN=FAM76A PE=2 SV=1
2	AFDB:Q5HYJ3	0.530	0.486	1.059E-38	339	0.749	0.678	Q5HYJ3.pdb.gz	FA76B_HUMAN Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B PE=1 SV=3
3	AFDB:Q38FD1	0.165	0.049	3.304E-2	1314	0.081	0.019	Q38FD1.pdb.gz	Q38FD1_TRYB2 DksA C4-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2650 PE=4 SV=1
4	AFDB:C8VG23	0.147	0.147	7.491E-2	306	0.127	0.127	C8VG23.pdb.gz	C8VG23_EMENI C2H2 finger domain protein, putative (AFU_orthologue AFUA_4G11480) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05583 PE=4 SV=1
5	PDB:4kfzB	0.124	0.192	2.001E-1	148	0.062	0.128	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
6	AFDB:P39083	0.122	0.042	2.738E-1	1007	0.107	0.033	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
7	AFDB:Q9EP71	0.155	0.070	3.850E-1	979	0.114	0.036	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
8	AFDB:Q7Z5H3	0.204	0.100	6.207E-1	698	0.104	0.046	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
9	AFDB:P39768	0.113	0.074	8.729E-1	609	0.127	0.064	P39768.pdb.gz	OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster OX=7227 GN=opa PE=1 SV=2
10	PDB:6hlqI	0.054	0.126	8.971E-1	111	0.039	0.108	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
11	PDB:6ydhA	0.048	0.195	1.028	62	0.033	0.161	6ydhA.pdb.gz
12	PDB:7od1A	0.078	0.062	1.028	430	0.055	0.040	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
13	AFDB:Q9TTK7	0.222	0.246	1.228	274	0.088	0.099	Q9TTK7.pdb.gz	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
14	AFDB:Q7XII4	0.202	0.197	1.506	316	0.104	0.101	Q7XII4.pdb.gz	REM41_ORYSJ Remorin 4.1 OS=Oryza sativa subsp. japonica OX=39947 GN=REM4.1 PE=1 SV=1
15	PDB:7oniH	0.111	0.091	1.548	380	0.039	0.032	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7uhyD	0.093	0.096	1.548	288	0.055	0.059	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:4xr8H	0.095	0.153	1.900	151	0.068	0.139	4xr8H.pdb.gz	Structure of the E6/E6AP/p53 complex required for HPV-mediated degradation of p53.
18	PDB:6sjvA	0.092	0.059	2.034	529	0.052	0.030	6sjvA.pdb.gz	Cellular target recognition by HPV18 and HPV49 oncoproteins
19	PDB:7d58L	0.050	0.300	2.331	47	0.029	0.191	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
20	PDB:1q14A	0.073	0.075	2.672	289	0.029	0.031	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TAV0	0.0	633	307	1.000	1.000	FA76A_HUMAN Protein FAM76A OS=Homo sapiens OX=9606 GN=FAM76A PE=2 SV=1
2	Q5HYJ3	1.84e-152	432	339	0.752	0.681	FA76B_HUMAN Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B PE=1 SV=3
3	Q586S4	0.16	36.2	1340	0.107	0.025	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
4	Q8TZY2	0.69	34.3	1177	0.072	0.019	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2
5	Q9VY77	1.2	33.5	728	0.078	0.033	AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster OX=7227 GN=jub PE=1 SV=3
6	O40942	1.6	33.1	2635	0.059	0.007	O40942_HHV8 Large tegument protein deneddylase OS=Human herpesvirus 8 OX=37296 PE=1 SV=1
7	Q2HR64	1.6	33.1	2635	0.059	0.007	LTP_HHV8P Large tegument protein deneddylase OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=ORF64 PE=1 SV=1
8	P0C483	2.1	32.0	239	0.101	0.130	RR3_ORYSA Small ribosomal subunit protein uS3c OS=Oryza sativa OX=4530 GN=rps3 PE=3 SV=1
9	P0C484	2.1	32.0	239	0.101	0.130	RR3_ORYSI Small ribosomal subunit protein uS3c OS=Oryza sativa subsp. indica OX=39946 GN=rps3 PE=3 SV=1
10	P0C485	2.1	32.0	239	0.101	0.130	RR3_ORYSJ Small ribosomal subunit protein uS3c OS=Oryza sativa subsp. japonica OX=39947 GN=rps3 PE=3 SV=1
11	Q5JR59	2.1	32.7	1369	0.081	0.018	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
12	Q6END5	2.1	32.0	239	0.101	0.130	RR3_ORYNI Small ribosomal subunit protein uS3c OS=Oryza nivara OX=4536 GN=rps3 PE=3 SV=1
13	Q13751	2.3	32.7	1172	0.049	0.013	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
14	A0A096LNU0	2.9	32.0	715	0.104	0.045	A0A096LNU0_HUMAN MCC regulator of WNT signaling pathway OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=1
15	Q2U6C3	3.0	32.3	4346	0.075	0.005	Q2U6C3_ASPOR Dynein heavy chain, cytoplasmic OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000298 PE=4 SV=1
16	P23508	3.1	32.0	829	0.104	0.039	CRCM_HUMAN Colorectal mutant cancer protein OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=2
17	D6REY2	3.4	32.0	766	0.104	0.042	D6REY2_HUMAN MCC regulator of WNT signaling pathway OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=1
18	A0A571BG59	3.7	32.0	4114	0.049	0.004	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
19	A0A5F8MPH8	3.7	32.0	4356	0.049	0.003	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
20	O54796	3.7	32.0	4114	0.049	0.004	O54796_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnx PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01544 CorA	9.1e+02	10.5	CorA-like Mg2+ transporter protein
2	PF16046 FAM76	1.2e-119	410.8	FAM76 protein
3	PF14883 GHL13	13	16.3	Hypothetical glycosyl hydrolase family 13

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9818.XP_007933994.1

Rank	PPI partner	STRING score	Description
1	9818.XP_007938553.1	0.666	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.984	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0048518	0.872	positive regulation of biological process
GO:0048522	0.834	positive regulation of cellular process
GO:0050896	0.694	response to stimulus
GO:0009605	0.556	response to external stimulus
GO:0071704	0.543	organic substance metabolic process
GO:0044238	0.523	primary metabolic process
GO:0044237	0.517	cellular metabolic process
GO:0048583	0.505	regulation of response to stimulus
GO:0010556	0.505	regulation of macromolecule biosynthetic process
GO:0006807	0.499	nitrogen compound metabolic process
GO:0043170	0.471	macromolecule metabolic process
GO:0051171	0.465	regulation of nitrogen compound metabolic process
GO:0010646	0.465	regulation of cell communication
GO:0023051	0.460	regulation of signaling
GO:0051716	0.459	cellular response to stimulus
GO:0010468	0.457	regulation of gene expression
GO:0009966	0.430	regulation of signal transduction
GO:0007154	0.429	cell communication
GO:1901360	0.409	organic cyclic compound metabolic process
GO:0046483	0.406	heterocycle metabolic process
GO:0034641	0.402	cellular nitrogen compound metabolic process
GO:0006950	0.381	response to stress
GO:0048519	0.379	negative regulation of biological process
GO:0006725	0.378	cellular aromatic compound metabolic process
GO:0090304	0.372	nucleic acid metabolic process
GO:0080090	0.368	regulation of primary metabolic process
GO:0031323	0.349	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0016020	0.498	membrane
GO:0005737	0.343	cytoplasm
GO:0043232	0.307	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]