StarFunc result for job id Q8TAX0

User Input

>input (266 residues)
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFA
NLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFC
GRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGF
CQSRTLAVHKTLHSQVKELKTSKIKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0K011	0.627	0.627	3.892E-42	266	0.977	0.977	B0K011.pdb.gz	OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus OX=10116 GN=Osr1 PE=2 SV=1
2	AFDB:Q5XJQ7	0.499	0.502	5.520E-32	264	0.763	0.769	Q5XJQ7.pdb.gz	OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio OX=7955 GN=osr1 PE=2 SV=1
3	AFDB:A0A1D5P5P2	0.425	0.290	1.372E-22	412	0.665	0.430	A0A1D5P5P2.pdb.gz
4	AFDB:P23803	0.319	0.218	2.099E-15	392	0.372	0.253	P23803.pdb.gz	ODD_DROME Protein odd-skipped OS=Drosophila melanogaster OX=7227 GN=odd PE=2 SV=3
5	AFDB:Q9VQS7	0.310	0.144	6.390E-14	578	0.380	0.175	Q9VQS7.pdb.gz	SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster OX=7227 GN=sob PE=2 SV=1
6	AFDB:Q3SY52	0.330	0.183	2.028E-11	487	0.244	0.133	Q3SY52.pdb.gz	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
7	AFDB:P10754	0.316	0.168	3.963E-11	512	0.271	0.141	P10754.pdb.gz	RHIT_MOUSE Transcriptional repressor Rhit OS=Mus musculus OX=10090 GN=Zfp13 PE=1 SV=2
8	AFDB:Q9NQZ8	0.319	0.176	4.237E-11	489	0.218	0.119	Q9NQZ8.pdb.gz	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
9	AFDB:P17029	0.321	0.155	4.844E-11	563	0.233	0.110	P17029.pdb.gz	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
10	AFDB:Q12901	0.318	0.159	6.771E-11	538	0.188	0.093	Q12901.pdb.gz	ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens OX=9606 GN=ZNF155 PE=1 SV=4
11	PDB:3w5kB	0.118	0.228	3.280E-3	110	0.105	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7dvqM	0.066	0.083	2.843	191	0.071	0.099	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:7uhyD	0.069	0.064	2.843	288	0.071	0.066	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7egb3	0.054	0.054	3.717	263	0.034	0.034	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:5lj5t	0.094	0.061	3.974	438	0.045	0.027	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
16	PDB:7vdvX	0.071	0.075	4.544	252	0.064	0.067	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
17	PDB:7ad8D	0.079	0.076	5.555	280	0.083	0.079	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
18	PDB:3j7a3	0.050	0.121	5.940	95	0.026	0.074	3j7a3.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
19	PDB:5gm6a	0.050	0.091	7.261	123	0.056	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:4c2mI	0.065	0.122	7.764	124	0.056	0.121	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0K011	0.0	535	266	0.977	0.977	OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus OX=10116 GN=Osr1 PE=2 SV=1
2	Q8TAX0	0.0	547	266	1.000	1.000	OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens OX=9606 GN=OSR1 PE=2 SV=1
3	Q9WVG7	0.0	535	266	0.977	0.977	OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus OX=10090 GN=Osr1 PE=1 SV=1
4	E1BWE8	1.60e-161	450	258	0.842	0.868	E1BWE8_CHICK Odd-skipped related transciption factor 1 OS=Gallus gallus OX=9031 GN=OSR1 PE=4 SV=2
5	Q66JF8	1.81e-161	450	259	0.850	0.873	OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis OX=8364 GN=osr1 PE=2 SV=1
6	P86413	1.55e-160	447	259	0.846	0.869	OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis OX=8355 GN=osr1 PE=2 SV=1
7	Q5XJQ7	4.28e-138	391	264	0.778	0.784	OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio OX=7955 GN=osr1 PE=2 SV=1
8	Q32NK7	6.52e-125	358	271	0.677	0.664	OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis OX=8355 GN=osr2-a PE=2 SV=1
9	Q8N2R0	8.46e-122	352	312	0.677	0.577	OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens OX=9606 GN=OSR2 PE=1 SV=2
10	Q91ZD1	1.05e-121	351	312	0.673	0.574	OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus OX=10090 GN=Osr2 PE=1 SV=1
11	Q567J8	1.32e-96	285	238	0.571	0.639	OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio OX=7955 GN=osr2 PE=2 SV=1
12	Q9VQS7	4.73e-49	172	578	0.278	0.128	SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster OX=7227 GN=sob PE=2 SV=1
13	P23803	2.74e-48	166	392	0.305	0.207	ODD_DROME Protein odd-skipped OS=Drosophila melanogaster OX=7227 GN=odd PE=2 SV=3
14	Q9VQU9	1.88e-47	169	744	0.308	0.110	BOWEL_DROME Protein bowel OS=Drosophila melanogaster OX=7227 GN=bowl PE=1 SV=1
15	P17028	9.63e-24	100	368	0.203	0.147	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
16	Q91VN1	3.64e-23	99.0	368	0.203	0.147	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
17	O88412	1.60e-20	92.8	524	0.158	0.080	O88412_MOUSE Zinc finger protein 105 OS=Mus musculus OX=10090 GN=Zfp105 PE=2 SV=1
18	P13682	2.45e-20	92.0	527	0.158	0.080	ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens OX=9606 GN=ZNF35 PE=1 SV=4
19	Q86TJ5	2.51e-20	92.0	538	0.169	0.084	ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens OX=9606 GN=ZNF554 PE=1 SV=1
20	Q9H8G1	2.66e-20	92.0	570	0.158	0.074	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	5.8	18.5	TFIIH C1-like domain
2	PF19148 DUF5830	4.1e+02	12.3	Family of unknown function (DUF5830)
3	PF09237 GAGA	1.7e+02	13.6	GAGA factor
4	PF01286 XPA_N	80	14.7	XPA protein N-terminal
5	PF01428 zf-AN1	1.4	20.4	AN1-like Zinc finger
6	PF00096 zf-C2H2	8.8e-10	49.6	Zinc finger, C2H2 type
7	PF13894 zf-C2H2_4	4e-05	35.1	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	0.014	26.7	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	4.8	18.8	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	1e-07	43.2	Zinc-finger double domain
11	PF12874 zf-met	2.7e+02	13.4	Zinc-finger of C2H2 type
12	PF09723 Zn-ribbon_8	5.6	18.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256474	0.680	Von Hippel-Lindau disease tumor suppressor
2	9606.ENSP00000359319	0.512	Paired box protein Pax-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140110	0.943	transcription regulator activity
GO:0003700	0.830	DNA-binding transcription factor activity
GO:0000976	0.606	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0050789	0.986	regulation of biological process
GO:0072001	0.986	renal system development
GO:0050794	0.984	regulation of cellular process
GO:0048513	0.982	animal organ development
GO:0001822	0.943	kidney development
GO:0048519	0.910	negative regulation of biological process
GO:0009987	0.895	cellular process
GO:0019222	0.888	regulation of metabolic process
GO:0060255	0.882	regulation of macromolecule metabolic process
GO:0080090	0.877	regulation of primary metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0031323	0.876	regulation of cellular metabolic process
GO:0048518	0.871	positive regulation of biological process
GO:0019219	0.871	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.845	positive regulation of cellular process
GO:0006355	0.742	regulation of DNA-templated transcription
GO:0048523	0.724	negative regulation of cellular process
GO:0009653	0.593	anatomical structure morphogenesis
GO:0050896	0.560	response to stimulus
GO:0009893	0.558	positive regulation of metabolic process
GO:0051173	0.545	positive regulation of nitrogen compound metabolic process
GO:0031325	0.545	positive regulation of cellular metabolic process
GO:0010604	0.538	positive regulation of macromolecule metabolic process
GO:0006357	0.484	regulation of transcription by RNA polymerase II
GO:0009888	0.460	tissue development
GO:0045892	0.452	negative regulation of DNA-templated transcription
GO:0045935	0.423	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.420	cellular response to stimulus
GO:0031328	0.419	positive regulation of cellular biosynthetic process
GO:0045893	0.399	positive regulation of DNA-templated transcription
GO:0042221	0.384	response to chemical
GO:0035295	0.356	tube development
GO:0008152	0.355	metabolic process
GO:0009887	0.327	animal organ morphogenesis
GO:0044238	0.326	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.985	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0005737	0.893	cytoplasm
GO:0005829	0.778	cytosol
GO:0016020	0.533	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]