StarFunc result for job id Q8TB24

User Input

>input (985 residues)
MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTC
PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE
KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
DSSLNPPQERGKPAEPPRDRAPGFPLVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVL
PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAGLGPLREEAMK
PGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
AELCTQAMALETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGV
SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
LYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTE
LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQLVIL
ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVY
RPLDGGGGGGGGSPPCLVVREPNFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NSK7	0.332	0.359	0.000	908	0.917	0.994	Q6NSK7.pdb.gz	Q6NSK7_HUMAN RIN3 protein OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=1
2	AFDB:Q8TB24	1.000	1.000	0.000	985	1.000	1.000	Q8TB24.pdb.gz	RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4
3	AFDB:P59729	0.387	0.389	2.954E-100	980	0.763	0.767	P59729.pdb.gz	RIN3_MOUSE Ras and Rab interactor 3 OS=Mus musculus OX=10090 GN=Rin3 PE=1 SV=2
4	PDB:4fl2A	0.085	0.147	2.836E-3	555	0.028	0.050	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
5	PDB:4k2rA	0.085	0.149	6.000E-3	551	0.022	0.040	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
6	PDB:1k9aB	0.096	0.202	8.328E-3	441	0.029	0.066	1k9aB.pdb.gz
7	PDB:4f7zA	0.074	0.077	1.269E-2	946	0.028	0.030	4f7zA.pdb.gz
8	AFDB:Q80U58	0.060	0.057	1.295E-2	1066	0.129	0.119	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
9	AFDB:Q7Z5K2	0.079	0.070	1.716E-2	1190	0.143	0.118	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
10	AFDB:Q9SE97	0.070	0.067	1.975E-2	1051	0.131	0.123	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
11	PDB:5xzrA	0.090	0.163	2.334E-2	519	0.025	0.048	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:2byvE	0.073	0.078	2.686E-2	922	0.025	0.027	2byvE.pdb.gz
13	PDB:2h8hA	0.089	0.195	2.950E-2	445	0.026	0.058	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	AFDB:E9PR38	0.076	0.078	3.010E-2	944	0.126	0.131	E9PR38.pdb.gz	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
15	AFDB:Q63767	0.080	0.081	3.154E-2	968	0.124	0.126	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
16	AFDB:F4K0Y5	0.103	0.091	3.306E-2	1165	0.116	0.098	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
17	PDB:1griA	0.082	0.356	4.094E-2	211	0.016	0.076	1griA.pdb.gz
18	AFDB:Q08562	0.047	0.038	4.178E-2	1619	0.095	0.058	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
19	PDB:1ka6A	0.080	0.675	5.683E-2	107	0.015	0.140	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
20	PDB:2lqnA	0.073	0.227	5.955E-2	303	0.022	0.073	2lqnA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59729	0.0	1278	980	0.765	0.769	RIN3_MOUSE Ras and Rab interactor 3 OS=Mus musculus OX=10090 GN=Rin3 PE=1 SV=2
2	Q6NSK7	0.0	1172	908	0.618	0.671	Q6NSK7_HUMAN RIN3 protein OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=1
3	Q8TB24	0.0	2006	985	1.000	1.000	RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4
4	Q8WYP3	8.06e-90	308	895	0.164	0.181	RIN2_HUMAN Ras and Rab interactor 2 OS=Homo sapiens OX=9606 GN=RIN2 PE=1 SV=1
5	Q13671	3.02e-37	153	783	0.130	0.163	RIN1_HUMAN Ras and Rab interactor 1 OS=Homo sapiens OX=9606 GN=RIN1 PE=1 SV=4
6	Q921Q7	3.07e-37	152	763	0.121	0.156	RIN1_MOUSE Ras and Rab interactor 1 OS=Mus musculus OX=10090 GN=Rin1 PE=1 SV=1
7	Q80UW3	1.18e-31	133	563	0.089	0.156	RINL_MOUSE Ras and Rab interactor-like protein OS=Mus musculus OX=10090 GN=Rinl PE=1 SV=1
8	Q8MQW8	1.34e-25	117	1789	0.102	0.056	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3
9	G5ECF0	1.43e-19	97.4	1890	0.075	0.039	G5ECF0_CAEEL SH2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rin-1 PE=1 SV=1
10	Q9UJ41	3.23e-08	59.7	491	0.035	0.069	RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=3
11	E9PFK9	3.60e-08	59.7	504	0.035	0.067	E9PFK9_HUMAN RAB guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=1
12	O18973	3.84e-08	59.3	492	0.035	0.069	RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus OX=9913 GN=RABGEF1 PE=1 SV=1
13	Q9JM13	5.33e-08	58.9	491	0.034	0.067	RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus OX=10090 GN=Rabgef1 PE=1 SV=1
14	Q6PAR5	7.11e-08	59.3	1458	0.060	0.040	GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gapvd1 PE=1 SV=2
15	Q14C86	8.95e-08	58.9	1478	0.034	0.022	GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2
16	F8W9S7	9.03e-08	58.9	1412	0.034	0.023	F8W9S7_HUMAN GTPase activating protein and VPS9 domains 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
17	Q9W0H9	1.77e-06	54.3	696	0.026	0.037	Q9W0H9_DROME Rabaptin-5-associated exchange factor for Rab5 OS=Drosophila melanogaster OX=7227 GN=Rabex-5 PE=1 SV=1
18	Q9LT31	5.47e-06	52.8	520	0.043	0.081	VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana OX=3702 GN=VPS9A PE=1 SV=1
19	Q9GYH7	1.10e-05	52.0	1093	0.026	0.024	RME6_CAEEL Receptor-mediated endocytosis protein 6 OS=Caenorhabditis elegans OX=6239 GN=rme-6 PE=1 SV=2
20	Q55AA6	1.13e-05	52.0	715	0.030	0.042	Q55AA6_DICDI Vacuolar sorting protein 9 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272038 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20464 MmeI_N	6.7e+02	11.9	MmeI, N-terminal domain
2	PF06394 Pepsin-I3	6e+02	12.1	Pepsin inhibitor-3-like repeated domain
3	PF00788 RA	2.6e+02	13.7	Ras association (RalGDS/AF-6) domain
4	PF03874 RNA_pol_Rpb4	3.6e+02	12.8	RNA polymerase Rpb4
5	PF00017 SH2	15	17.1	SH2 domain
6	PF05591 T6SS_VipA	3.4e+02	12.4	Type VI secretion system, VipA, VC_A0107 or Hcp2
7	PF02204 VPS9	3e-24	96.6	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353444	0.984	Ras-related protein Rab-5B
2	9606.ENSP00000316779	0.969	Myc box-dependent-interacting protein 1
3	9606.ENSP00000273047	0.962	Ras-related protein Rab-5A
4	9606.ENSP00000461945	0.948	Ras-related protein Rab-31
5	9606.ENSP00000447053	0.944	Ras-related protein Rab-5C
6	9606.ENSP00000352264	0.943	CD2-associated protein
7	9606.ENSP00000350386	0.905	Rab proteins geranylgeranyltransferase component A 1
8	9606.ENSP00000355511	0.905	Rab proteins geranylgeranyltransferase component A 2
9	9606.ENSP00000394071	0.902	Rab GDP dissociation inhibitor alpha
10	9606.ENSP00000369538	0.901	Rab GDP dissociation inhibitor beta
11	9606.ENSP00000381109	0.749	Zinc finger CW-type and PWWP domain containing 1
12	9606.ENSP00000199447	0.743	Thioredoxin domain-containing protein 3
13	9606.ENSP00000353462	0.740	Cas scaffolding protein family member 4
14	9606.ENSP00000431840	0.740	Sodium/potassium/calcium exchanger 4
15	9606.ENSP00000342858	0.700	Fermitin family homolog 2
16	9606.ENSP00000263094	0.695	ATP-binding cassette sub-family A member 7
17	9606.ENSP00000405338	0.689	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
18	9606.ENSP00000364114	0.676	HLA class II histocompatibility antigen, DR beta 5 chain
19	9606.ENSP00000377015	0.671	Phosphatidylinositol-binding clathrin assembly protein
20	9606.ENSP00000260197	0.662	Sortilin-related receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.996	enzyme binding
GO:0031267	0.992	small GTPase binding
GO:0030234	0.991	enzyme regulator activity
GO:0140678	0.990	molecular function inhibitor activity
GO:0005085	0.983	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0032879	0.978	regulation of localization
GO:0040012	0.976	regulation of locomotion
GO:0048519	0.972	negative regulation of biological process
GO:0048523	0.955	negative regulation of cellular process
GO:0048583	0.949	regulation of response to stimulus
GO:0016043	0.946	cellular component organization
GO:0051049	0.903	regulation of transport
GO:0051128	0.666	regulation of cellular component organization
GO:0030334	0.576	regulation of cell migration
GO:0065008	0.510	regulation of biological quality
GO:0060627	0.491	regulation of vesicle-mediated transport
GO:0048585	0.448	negative regulation of response to stimulus
GO:0030100	0.440	regulation of endocytosis
GO:0002682	0.422	regulation of immune system process
GO:0051129	0.417	negative regulation of cellular component organization
GO:0050896	0.404	response to stimulus
GO:0048259	0.377	regulation of receptor-mediated endocytosis
GO:0032535	0.322	regulation of cellular component size
GO:0032101	0.318	regulation of response to external stimulus
GO:0051051	0.314	negative regulation of transport
GO:0051716	0.301	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031410	0.983	cytoplasmic vesicle
GO:0005768	0.894	endosome
GO:0016020	0.863	membrane
GO:0005769	0.704	early endosome
GO:0030139	0.592	endocytic vesicle
GO:0070013	0.384	intracellular organelle lumen
GO:0030659	0.367	cytoplasmic vesicle membrane
GO:0032991	0.359	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]