StarFunc result for job id Q8TB40

User Input

>input (342 residues)
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVT
VSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGA
EDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN
PSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISE
YIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TB40	1.000	1.000	3.985E-74	342	1.000	1.000	Q8TB40.pdb.gz	ABHD4_HUMAN (Lyso)-N-acylphosphatidylethanolamine lipase OS=Homo sapiens OX=9606 GN=ABHD4 PE=1 SV=1
2	AFDB:Q6QA69	0.914	0.891	7.129E-50	351	0.547	0.533	Q6QA69.pdb.gz	ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus OX=10116 GN=Abhd5 PE=1 SV=1
3	AFDB:Q5U191	0.880	0.668	5.341E-42	454	0.471	0.355	Q5U191.pdb.gz	Q5U191_DROME Pummelig, isoform A OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
4	AFDB:O02218	0.880	0.838	1.086E-36	360	0.365	0.347	O02218.pdb.gz	LID1_CAEEL Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2
5	AFDB:A0A2U3TZT9	0.628	0.766	6.938E-32	278	0.409	0.504	A0A2U3TZT9.pdb.gz	A0A2U3TZT9_HUMAN Abhydrolase domain containing 5, lysophosphatidic acid acyltransferase OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
6	AFDB:Q581X1	0.862	0.827	2.242E-30	357	0.342	0.328	Q581X1.pdb.gz	Q581X1_TRYB2 AB hydrolase-1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.650 PE=4 SV=1
7	AFDB:O22975	0.808	0.669	1.351E-29	418	0.330	0.270	O22975.pdb.gz	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
8	AFDB:O14249	0.780	0.634	9.825E-28	428	0.284	0.227	O14249.pdb.gz	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
9	AFDB:Q12385	0.770	0.673	1.041E-23	394	0.231	0.201	Q12385.pdb.gz	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
10	AFDB:P53264	0.790	0.617	2.998E-22	445	0.254	0.196	P53264.pdb.gz	CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLD1 PE=1 SV=1
11	PDB:3kxpA	0.590	0.737	3.472E-14	268	0.164	0.209	3kxpA.pdb.gz
12	PDB:5jzsB	0.608	0.718	3.898E-14	284	0.178	0.215	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
13	PDB:5aljA	0.508	0.345	5.600E-13	523	0.173	0.113	5aljA.pdb.gz	Successful Generation of Structural Information for Fragment-Based Drug Discovery.
14	PDB:4g8bA	0.578	0.699	7.481E-13	277	0.140	0.173	4g8bA.pdb.gz	High-resolution structures of AidH complexes provide insights into a novel catalytic mechanism for N-acyl homoserine lactonase
15	PDB:1u2eA	0.619	0.725	1.415E-12	286	0.143	0.171	1u2eA.pdb.gz
16	PDB:2ocgA	0.574	0.749	3.788E-12	254	0.114	0.154	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
17	PDB:2zjfA	0.598	0.591	7.164E-12	346	0.152	0.150	2zjfA.pdb.gz	The molecular structure of epoxide hydrolase B from Mycobacterium tuberculosis and its complex with a urea-based inhibitor.
18	PDB:3bf7A	0.519	0.673	7.164E-12	255	0.140	0.188	3bf7A.pdb.gz
19	PDB:1cr6B	0.629	0.418	8.523E-12	541	0.167	0.105	1cr6B.pdb.gz	Detoxification of environmental mutagens and carcinogens: structure, mechanism, and evolution of liver epoxide hydrolase.
20	PDB:3e3aB	0.532	0.647	9.032E-12	275	0.164	0.204	3e3aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TB40	0.0	711	342	1.000	1.000	ABHD4_HUMAN (Lyso)-N-acylphosphatidylethanolamine lipase OS=Homo sapiens OX=9606 GN=ABHD4 PE=1 SV=1
2	Q8VD66	0.0	692	342	0.965	0.965	ABHD4_MOUSE (Lyso)-N-acylphosphatidylethanolamine lipase OS=Mus musculus OX=10090 GN=Abhd4 PE=1 SV=1
3	A0A0S2Z5D6	1.43e-129	376	349	0.541	0.530	A0A0S2Z5D6_HUMAN Abhydrolase domain containing 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ABHD5 PE=2 SV=1
4	Q8WTS1	1.43e-129	376	349	0.541	0.530	ABHD5_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
5	Q9DBL9	7.12e-127	369	351	0.535	0.521	ABHD5_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Mus musculus OX=10090 GN=Abhd5 PE=1 SV=1
6	Q6QA69	7.36e-127	369	351	0.535	0.521	ABHD5_RAT 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus OX=10116 GN=Abhd5 PE=1 SV=1
7	Q5U191	2.82e-116	346	454	0.480	0.361	Q5U191_DROME Pummelig, isoform A OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
8	Q7JQU9	1.56e-113	336	387	0.456	0.403	Q7JQU9_DROME AT25873p OS=Drosophila melanogaster OX=7227 GN=puml PE=1 SV=1
9	A0A2U3TZT9	1.92e-89	271	278	0.401	0.493	A0A2U3TZT9_HUMAN Abhydrolase domain containing 5, lysophosphatidic acid acyltransferase OS=Homo sapiens OX=9606 GN=ABHD5 PE=1 SV=1
10	O02218	1.15e-83	259	360	0.383	0.364	LID1_CAEEL Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2
11	Q581X1	4.92e-52	177	357	0.348	0.333	Q581X1_TRYB2 AB hydrolase-1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.650 PE=4 SV=1
12	O22975	2.92e-48	169	418	0.336	0.275	LPAAT_ARATH 1-acylglycerol-3-phosphate O-acyltransferase OS=Arabidopsis thaliana OX=3702 GN=At4g24160 PE=1 SV=1
13	O14249	1.46e-30	122	428	0.275	0.220	CLD1_SCHPO Probable cardiolipin-specific deacylase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.03c PE=3 SV=1
14	Q12385	9.53e-19	88.6	394	0.225	0.195	ICT1_YEAST 1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ICT1 PE=3 SV=1
15	P53264	1.29e-16	82.8	445	0.249	0.191	CLD1_YEAST Cardiolipin-specific deacylase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLD1 PE=1 SV=1
16	Q04623	6.26e-15	77.8	453	0.237	0.179	ECM18_YEAST Protein ECM18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM18 PE=1 SV=1
17	O23227	1.88e-13	72.8	378	0.193	0.175	O23227_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.830 PE=1 SV=2
18	Q1QEU6	1.50e-09	60.8	315	0.120	0.130	Q1QEU6_PSYCK Alpha/beta hydrolase fold protein OS=Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5) OX=335284 GN=Pcryo_0023 PE=1 SV=1
19	Q8LFX7	3.18e-07	53.9	469	0.146	0.107	BDG1_ARATH Probable lysophospholipase BODYGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=BDG1 PE=2 SV=1
20	P9WNH3	8.03e-07	52.4	341	0.187	0.188	Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2715 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	8.6e-21	86.3	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	2.3e-15	69.3	Alpha/beta hydrolase family
3	PF16175 DUF4875	5.8e+02	12.0	Domain of unknown function (DUF4875)
4	PF06028 DUF915	32	15.3	Alpha/beta hydrolase of unknown function (DUF915)
5	PF00756 Esterase	71	14.5	Putative esterase
6	PF12146 Hydrolase_4	3.8e-09	47.7	Serine aminopeptidase, S33
7	PF10230 LIDHydrolase	53	14.8	Lipid-droplet associated hydrolase
8	PF01764 Lipase_3	6.4e+02	11.6	Lipase (class 3)
9	PF03096 Ndr	4.5	17.5	Ndr family
10	PF03403 PAF-AH_p_II	0.016	25.4	Platelet-activating factor acetylhydrolase, isoform II
11	PF07819 PGAP1	1.2e+02	13.9	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000414558

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261386	0.847	Glycerophosphodiester phosphodiesterase 1
2	9606.ENSP00000407112	0.841	N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
3	9606.ENSP00000365725	0.821	Monoacylglycerol lipase ABHD12
4	9606.ENSP00000364035	0.804	Fatty-acid amide hydrolase 2
5	9606.ENSP00000265052	0.788	Monoglyceride lipase
6	9606.ENSP00000243167	0.751	Fatty-acid amide hydrolase 1
7	9606.ENSP00000420315	0.746	Monoacylglycerol lipase ABHD6
8	9606.ENSP00000381937	0.711	Protein ABHD18
9	9606.ENSP00000352833	0.708	Tyrosine-protein phosphatase non-receptor type 22
10	9606.ENSP00000477868	0.705	TOX high mobility group box family member 4
11	9606.ENSP00000336693	0.699	Belongs to the serine esterase family
12	9606.ENSP00000257215	0.688	Sn1-specific diacylglycerol lipase alpha
13	9606.ENSP00000337701	0.673	Patatin-like phospholipase domain-containing protein 2
14	9606.ENSP00000289119	0.671	Phospholipase ABHD3
15	9606.ENSP00000250498	0.669	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
16	9606.ENSP00000297056	0.665	Sn1-specific diacylglycerol lipase beta
17	9606.ENSP00000268129	0.660	Monoacylglycerol lipase ABHD2
18	9606.ENSP00000286733	0.645	N-acylethanolamine-hydrolyzing acid amidase
19	9606.ENSP00000222800	0.638	Protein ABHD11
20	9606.ENSP00000247706	0.638	Protein ABHD8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016788	0.998	hydrolase activity, acting on ester bonds
GO:0005515	0.995	protein binding
GO:0052689	0.965	carboxylic ester hydrolase activity
GO:0016298	0.931	lipase activity
GO:0004620	0.666	phospholipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046486	0.998	glycerolipid metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0006644	0.996	phospholipid metabolic process
GO:0006650	0.981	glycerophospholipid metabolic process
GO:0044281	0.389	small molecule metabolic process
GO:0009056	0.346	catabolic process
GO:1901575	0.332	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0012505	0.978	endomembrane system
GO:0031090	0.932	organelle membrane
GO:0042175	0.877	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005783	0.877	endoplasmic reticulum
GO:0031984	0.777	organelle subcompartment
GO:0043232	0.734	intracellular non-membrane-bounded organelle
GO:0098827	0.723	endoplasmic reticulum subcompartment
GO:0005789	0.665	endoplasmic reticulum membrane
GO:0005829	0.592	cytosol
GO:0005811	0.458	lipid droplet
GO:0005634	0.398	nucleus
GO:0031974	0.349	membrane-enclosed lumen
GO:0070013	0.337	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.998	Acting on ester bonds.
EC:3.1.1.-	0.965	Carboxylic ester hydrolases.

[back to server]