StarFunc result for job id Q8TB45

User Input

>input (409 residues)
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQE
THDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSP
PVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGP
AAAAGMKVCQFVVSVNGLNVLHVDYRTVSNLILTGPRTIVMEVMEELEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TB45	1.000	1.000	1.742E-77	409	1.000	1.000	Q8TB45.pdb.gz	DPTOR_HUMAN DEP domain-containing mTOR-interacting protein OS=Homo sapiens OX=9606 GN=DEPTOR PE=1 SV=2
2	PDB:7pe9I	0.491	0.627	3.314E-50	317	0.768	0.991	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
3	AFDB:F1R6J2	0.248	0.071	2.124E-20	1622	0.215	0.054	F1R6J2.pdb.gz	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
4	AFDB:Q8TCU6	0.249	0.074	1.493E-19	1659	0.232	0.057	Q8TCU6.pdb.gz	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
5	AFDB:Q70Z35	0.237	0.070	2.861E-19	1606	0.232	0.059	Q70Z35.pdb.gz	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
6	PDB:6pcvA	0.230	0.133	1.509E-9	754	0.166	0.090	6pcvA.pdb.gz
7	AFDB:Q6R005	0.211	0.113	4.455E-7	801	0.108	0.055	Q6R005.pdb.gz	DLG4_DANRE Disks large homolog 4 OS=Danio rerio OX=7955 GN=dlg4 PE=2 SV=1
8	AFDB:Q8R4H2	0.197	0.054	5.644E-7	1543	0.086	0.023	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
9	PDB:7rx9A	0.209	0.198	5.906E-7	432	0.081	0.076	7rx9A.pdb.gz
10	AFDB:Q9VCX1	0.197	0.054	5.987E-7	1541	0.090	0.024	Q9VCX1.pdb.gz	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
11	PDB:2byvE	0.211	0.095	7.052E-7	922	0.115	0.051	2byvE.pdb.gz
12	AFDB:A1ZAN6	0.192	0.032	8.535E-7	2559	0.103	0.016	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
13	PDB:4f7zA	0.213	0.094	1.131E-6	946	0.110	0.048	4f7zA.pdb.gz
14	AFDB:Q92796	0.198	0.101	1.291E-6	817	0.073	0.037	Q92796.pdb.gz	DLG3_HUMAN Disks large homolog 3 OS=Homo sapiens OX=9606 GN=DLG3 PE=1 SV=2
15	AFDB:D3ZWS0	0.197	0.050	1.840E-6	1663	0.081	0.020	D3ZWS0.pdb.gz	D3ZWS0_RAT Scribble planar cell polarity protein OS=Rattus norvegicus OX=10116 GN=Scrib PE=1 SV=2
16	PDB:7p73A	0.196	0.191	8.954E-6	420	0.037	0.036	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:5n7dA	0.184	0.178	2.920E-5	423	0.051	0.050	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
18	PDB:6t36A	0.186	0.760	3.924E-5	93	0.037	0.161	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
19	PDB:7pc3A	0.189	0.191	4.970E-5	405	0.027	0.027	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.191	0.188	6.679E-5	415	0.061	0.060	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TB45	0.0	852	409	1.000	1.000	DPTOR_HUMAN DEP domain-containing mTOR-interacting protein OS=Homo sapiens OX=9606 GN=DEPTOR PE=1 SV=2
2	Q70Z35	7.92e-38	148	1606	0.281	0.072	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
3	Q3LAC4	1.42e-37	147	1598	0.279	0.071	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
4	Q8TCU6	6.03e-36	142	1659	0.284	0.070	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
5	F1R6J2	1.36e-34	138	1622	0.289	0.073	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
6	A0A8I6GLR6	1.97e-34	138	1646	0.284	0.070	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
7	Q69ZK0	3.18e-34	137	1650	0.281	0.070	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
8	D3ZS72	2.24e-29	123	1635	0.276	0.069	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
9	Q9EQZ6	8.68e-12	69.3	1011	0.086	0.035	RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1
10	Q8WZA2	9.91e-11	66.2	1011	0.076	0.031	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
11	Q7Z3F1	9.78e-09	59.7	870	0.086	0.040	LYCHS_HUMAN Lysosomal cholesterol signaling protein OS=Homo sapiens OX=9606 GN=GPR155 PE=1 SV=2
12	Q9VCX1	5.05e-08	57.8	1541	0.064	0.017	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
13	B2KTE3	1.99e-07	55.8	2091	0.064	0.012	B2KTE3_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
14	B2KTE1	2.02e-07	55.8	2100	0.064	0.012	B2KTE1_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
15	B2KTE4	2.09e-07	55.8	2075	0.064	0.013	B2KTE4_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
16	B2KTE2	2.11e-07	55.8	2084	0.064	0.012	B2KTE2_DANRE 1-phosphatidylinositol-3-phosphate 5-kinase OS=Danio rerio OX=7955 GN=pip5k3 PE=2 SV=1
17	M9PC26	2.53e-07	55.5	2021	0.078	0.016	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
18	P47170	5.50e-07	54.3	1584	0.095	0.025	IML1_YEAST Vacuolar membrane-associated protein IML1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IML1 PE=1 SV=1
19	H9KV90	9.85e-07	53.5	2169	0.083	0.016	H9KV90_HUMAN SH3 and multiple ankyrin repeat domains 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=1
20	Q9Y566	1.05e-06	53.5	2161	0.083	0.016	SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=SHANK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13233 Complex1_LYR_2	5.8e+02	12.6	Complex1_LYR-like
2	PF00610 DEP	1.3e-42	155.1	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
3	PF00595 PDZ	3.2e+02	13.1	PDZ domain
4	PF13180 PDZ_2	2.6e+02	13.4	PDZ domain
5	PF17820 PDZ_6	0.089	24.0	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296782	0.999	Rapamycin-insensitive companion of mTOR
2	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
3	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
4	9606.ENSP00000456405	0.999	Target of rapamycin complex subunit LST8
5	9606.ENSP00000375711	0.998	Proline-rich AKT1 substrate 1
6	9606.ENSP00000384848	0.997	Proline-rich protein 5
7	9606.ENSP00000265960	0.992	Target of rapamycin complex 2 subunit MAPKAP1
8	9606.ENSP00000359206	0.980	F-box/WD repeat-containing protein 1A
9	9606.ENSP00000362547	0.978	TELO2-interacting protein 1 homolog
10	9606.ENSP00000262187	0.972	GTP-binding protein Rheb
11	9606.ENSP00000219476	0.969	Tuberin
12	9606.ENSP00000362092	0.965	Ras-related GTP-binding protein C
13	9606.ENSP00000451828	0.965	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000298552	0.958	Hamartin
15	9606.ENSP00000369899	0.957	Ras-related GTP-binding protein A
16	9606.ENSP00000262850	0.953	Ras-related GTP-binding protein B
17	9606.ENSP00000358423	0.944	Ras-related GTP-binding protein D
18	9606.ENSP00000375892	0.926	RAC-beta serine/threonine-protein kinase
19	9606.ENSP00000306330	0.915	14-3-3 protein gamma
20	9606.ENSP00000225577	0.911	Ribosomal protein S6 kinase beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0031399	0.988	regulation of protein modification process
GO:0019220	0.987	regulation of phosphate metabolic process
GO:0032006	0.987	regulation of TOR signaling
GO:0031324	0.987	negative regulation of cellular metabolic process
GO:0051172	0.986	negative regulation of nitrogen compound metabolic process
GO:0009968	0.986	negative regulation of signal transduction
GO:0010605	0.985	negative regulation of macromolecule metabolic process
GO:0065008	0.979	regulation of biological quality
GO:0071840	0.977	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0051248	0.963	negative regulation of protein metabolic process
GO:0051338	0.957	regulation of transferase activity
GO:0042325	0.956	regulation of phosphorylation
GO:0045936	0.953	negative regulation of phosphate metabolic process
GO:0001932	0.951	regulation of protein phosphorylation
GO:0044092	0.945	negative regulation of molecular function
GO:0010941	0.944	regulation of cell death
GO:0031400	0.941	negative regulation of protein modification process
GO:1902532	0.941	negative regulation of intracellular signal transduction
GO:0042326	0.936	negative regulation of phosphorylation
GO:0008361	0.933	regulation of cell size
GO:0043086	0.929	negative regulation of catalytic activity
GO:0043549	0.875	regulation of kinase activity
GO:0045859	0.873	regulation of protein kinase activity
GO:0032007	0.856	negative regulation of TOR signaling
GO:0045792	0.851	negative regulation of cell size
GO:0042981	0.850	regulation of apoptotic process
GO:0001933	0.844	negative regulation of protein phosphorylation
GO:0051348	0.837	negative regulation of transferase activity
GO:1903432	0.794	regulation of TORC1 signaling
GO:0033673	0.777	negative regulation of kinase activity
GO:0006469	0.752	negative regulation of protein kinase activity
GO:2001233	0.726	regulation of apoptotic signaling pathway
GO:0050896	0.693	response to stimulus
GO:0048518	0.596	positive regulation of biological process
GO:0051716	0.533	cellular response to stimulus
GO:0007154	0.520	cell communication
GO:2001236	0.514	regulation of extrinsic apoptotic signaling pathway
GO:0007165	0.499	signal transduction
GO:0048522	0.392	positive regulation of cellular process
GO:1904262	0.361	negative regulation of TORC1 signaling
GO:0008152	0.336	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0071944	0.986	cell periphery
GO:0043229	0.985	intracellular organelle
GO:0043227	0.967	membrane-bounded organelle
GO:0005829	0.962	cytosol
GO:0043231	0.962	intracellular membrane-bounded organelle
GO:0016020	0.955	membrane
GO:0005886	0.944	plasma membrane
GO:0070013	0.896	intracellular organelle lumen
GO:0005634	0.880	nucleus
GO:0032991	0.663	protein-containing complex
GO:0031981	0.520	nuclear lumen
GO:0005654	0.475	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]