StarFunc result for job id Q8TB68

User Input

>input (274 residues)
MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLE
LEGSLAGSPPGLAPPQPPPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH
ALPHPPPTHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKI
VTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAPPCPALCLQADRGRRVF
PSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7R8	0.301	0.301	3.666E-38	274	1.000	1.000	A0A024R7R8.pdb.gz
2	AFDB:O95819	0.158	0.042	2.801E-1	1239	0.212	0.047	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
3	AFDB:O53930	0.186	0.097	1.039	597	0.150	0.069	O53930.pdb.gz	O53930_MYCTU Possible integral membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1779c PE=1 SV=1
4	AFDB:P09087	0.132	0.078	1.039	493	0.150	0.083	P09087.pdb.gz	ABDB_DROME Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3
5	AFDB:B5X0I6	0.205	0.059	1.293	1091	0.117	0.029	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
6	AFDB:E9Q6B2	0.149	0.125	1.293	420	0.204	0.133	E9Q6B2.pdb.gz	CC85C_MOUSE Coiled-coil domain-containing protein 85C OS=Mus musculus OX=10090 GN=Ccdc85c PE=1 SV=1
7	AFDB:Q17796	0.159	0.069	1.496	729	0.102	0.038	Q17796.pdb.gz	Q17796_CAEEL Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Caenorhabditis elegans OX=6239 GN=hgrs-1 PE=1 SV=2
8	AFDB:Q68UI8	0.207	0.098	1.496	603	0.168	0.076	Q68UI8.pdb.gz	CCD61_CHLRE Variable flagella 3 OS=Chlamydomonas reinhardtii OX=3055 GN=VFL3 PE=1 SV=1
9	AFDB:Q3YEC7	0.102	0.053	1.731	729	0.219	0.082	Q3YEC7.pdb.gz	RABL6_HUMAN Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2
10	AFDB:F1LXN4	0.119	0.026	2.153	1551	0.190	0.034	F1LXN4.pdb.gz	F1LXN4_RAT Protocadherin related 15 OS=Rattus norvegicus OX=10116 GN=Pcdh15 PE=4 SV=4
11	PDB:4n78F	0.187	0.301	8.032	156	0.047	0.083	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C6T3	0.0	511	269	0.967	0.985	PRR7_RAT Proline-rich protein 7 OS=Rattus norvegicus OX=10116 GN=Prr7 PE=1 SV=1
2	Q8TB68	0.0	543	274	1.000	1.000	PRR7_HUMAN Proline-rich protein 7 OS=Homo sapiens OX=9606 GN=PRR7 PE=1 SV=1
3	Q3V0I2	3.56e-125	358	269	0.905	0.922	PRR7_MOUSE Proline-rich protein 7 OS=Mus musculus OX=10090 GN=Prr7 PE=1 SV=1
4	E7EXZ8	5.41e-39	138	245	0.427	0.478	E7EXZ8_DANRE Proline-rich 7 (synaptic) OS=Danio rerio OX=7955 GN=prr7 PE=4 SV=2
5	Q9NX94	0.056	37.0	342	0.047	0.038	WBP1L_HUMAN WW domain binding protein 1-like OS=Homo sapiens OX=9606 GN=WBP1L PE=1 SV=2
6	Q8BGW2	0.11	36.2	348	0.044	0.034	WBP1L_MOUSE WW domain binding protein 1-like OS=Mus musculus OX=10090 GN=Wbp1l PE=2 SV=1
7	Q96G27	0.41	34.3	269	0.047	0.048	WBP1_HUMAN WW domain-binding protein 1 OS=Homo sapiens OX=9606 GN=WBP1 PE=1 SV=1
8	A1Z9L0	1.4	33.1	1001	0.117	0.032	A1Z9L0_DROME LD05087p OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
9	A0A0B4KFX4	1.9	32.3	1046	0.117	0.031	A0A0B4KFX4_DROME Reduction in Cnn dots 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
10	Q8NEW0	2.4	32.0	376	0.073	0.053	ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens OX=9606 GN=SLC30A7 PE=1 SV=1
11	A0A0B4KEP1	2.8	32.0	1066	0.117	0.030	A0A0B4KEP1_DROME Reduction in Cnn dots 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
12	M9MS40	8.0	30.8	3282	0.088	0.007	M9MS40_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
13	M9PH39	8.0	30.8	3266	0.088	0.007	M9PH39_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
14	Q9W321	8.0	30.8	3276	0.088	0.007	Q9W321_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=2
15	O62011	8.6	30.4	1054	0.084	0.022	O62011_CAEEL MUTator OS=Caenorhabditis elegans OX=6239 GN=mut-16 PE=1 SV=4
16	A0A060XC77	9.0	30.4	804	0.055	0.019	A0A060XC77_ONCMY 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00062333001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07219 HemY_N	2.9e+02	13.0	HemY protein N-terminus
2	PF05083 LST1	8.4e+02	11.7	LST-1 protein
3	PF15471 TMEM171	29	15.1	Transmembrane protein family 171
4	PF11669 WBP-1	0.014	27.5	WW domain-binding protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357733	0.825	Proline-rich protein 9
2	9606.ENSP00000384848	0.787	Proline-rich protein 5
3	9606.ENSP00000382428	0.768	Disks large homolog 4
4	9606.ENSP00000251607	0.758	CCA tRNA nucleotidyltransferase 1, mitochondrial
5	9606.ENSP00000311280	0.674	ETS-related transcription factor Elf-4
6	9606.ENSP00000431040	0.642	Mitochondrial ribosomal protein L22
7	9606.ENSP00000378887	0.632	Dehydrogenase/reductase SDR family member 7B
8	9606.ENSP00000480832	0.627	NOP16 nucleolar protein
9	9606.ENSP00000379704	0.606	Neuronal-specific septin-3
10	9606.ENSP00000317836	0.554	Proline-rich protein 15
11	9606.ENSP00000285873	0.553	Gem-associated protein 5
12	9606.ENSP00000421489	0.520	Tigger transposable element-derived protein 5
13	9606.ENSP00000385787	0.519	Ribonucleases P/MRP protein subunit POP1
14	9606.ENSP00000445979	0.519	Zinc finger protein 623
15	9606.ENSP00000263697	0.512	DnaJ homolog subfamily C member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.733	protein-containing complex binding
GO:0019899	0.545	enzyme binding
GO:0043168	0.306	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1903320	0.992	regulation of protein modification by small protein conjugation or removal
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0031400	0.980	negative regulation of protein modification process
GO:1903321	0.972	negative regulation of protein modification by small protein conjugation or removal
GO:0031396	0.957	regulation of protein ubiquitination
GO:0031397	0.950	negative regulation of protein ubiquitination
GO:0043085	0.878	positive regulation of catalytic activity
GO:0051345	0.868	positive regulation of hydrolase activity
GO:0052548	0.864	regulation of endopeptidase activity
GO:2000116	0.821	regulation of cysteine-type endopeptidase activity
GO:0010952	0.818	positive regulation of peptidase activity
GO:0048522	0.799	positive regulation of cellular process
GO:0050896	0.763	response to stimulus
GO:0010950	0.748	positive regulation of endopeptidase activity
GO:0051716	0.709	cellular response to stimulus
GO:0001775	0.683	cell activation
GO:0043281	0.671	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048856	0.667	anatomical structure development
GO:0010941	0.656	regulation of cell death
GO:2001056	0.639	positive regulation of cysteine-type endopeptidase activity
GO:0048523	0.628	negative regulation of cellular process
GO:0002521	0.595	leukocyte differentiation
GO:0002376	0.567	immune system process
GO:0046649	0.532	lymphocyte activation
GO:0042981	0.531	regulation of apoptotic process
GO:0007154	0.502	cell communication
GO:0023052	0.498	signaling
GO:0007267	0.488	cell-cell signaling
GO:0042110	0.426	T cell activation
GO:0030098	0.426	lymphocyte differentiation
GO:0043280	0.419	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0033077	0.392	T cell differentiation in thymus
GO:0031323	0.374	regulation of cellular metabolic process
GO:0048583	0.325	regulation of response to stimulus
GO:0008152	0.321	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0016020	0.996	membrane
GO:0005886	0.994	plasma membrane
GO:0043232	0.878	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]