StarFunc result for job id Q8TB72

User Input

>input (1066 residues)
MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQP
IMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGNFGTRD
AETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQ
ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQFDYP
GNQVPMDSSGATVGLFDYNSQQQLFQRTNALTVQQLTAAQQQQYALAAAQQPHIAGVFSA
GLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPWGVYPANLFQQ
QAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQGQQGQQAESLAAAAAANPTLA
FGQGLATGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSAAAQAAA
AAAAGGTASSLTGSTNGLFRPIGTQPPQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFS
HGPGQPGSTSLGFGSGNSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSS
SLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSSLHLGGLTNGSG
RYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRSDIMPSGRSRLLEDFRNNRFP
NLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVI
QKFFEFGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQVISEMVKELDGH
VLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAE
QTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASN
VVEKCVTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKII
MHKIRPHITTLRKYTYGKHILAKLEKYYLKNSPDLGPIGGPPNGML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80U58	0.470	0.470	2.797E-100	1066	0.977	0.977	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
2	AFDB:Q5T1Z8	0.361	0.317	2.109E-77	1224	0.777	0.676	Q5T1Z8.pdb.gz	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
3	AFDB:A0A0R4IWL6	0.396	0.368	1.055E-75	1152	0.735	0.680	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
4	AFDB:E9PR38	0.366	0.411	5.891E-67	944	0.636	0.718	E9PR38.pdb.gz	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
5	AFDB:P25822	0.348	0.245	1.020E-41	1533	0.418	0.291	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
6	AFDB:Q8I3S3	0.272	0.160	3.777E-22	1894	0.160	0.090	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
7	AFDB:P25339	0.288	0.344	1.961E-21	888	0.182	0.218	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
8	AFDB:Q9P789	0.214	0.214	6.704E-12	1065	0.188	0.188	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
9	PDB:5svdA	0.197	0.323	1.949E-6	543	0.056	0.110	5svdA.pdb.gz
10	AFDB:E5FYH1	0.120	0.085	3.161E-4	1653	0.134	0.087	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
11	PDB:5tbkA	0.200	0.409	7.043E-4	417	0.049	0.125	5tbkA.pdb.gz
12	AFDB:Q9W517	0.145	0.100	1.393E-3	1741	0.166	0.102	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
13	PDB:1z3hB	0.221	0.252	8.000E-3	914	0.046	0.054	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
14	PDB:3tpoA	0.179	0.342	9.432E-3	438	0.040	0.098	3tpoA.pdb.gz
15	PDB:7p3xB	0.165	0.247	1.366E-2	621	0.052	0.089	7p3xB.pdb.gz
16	PDB:4a3tB	0.142	0.250	1.484E-2	459	0.052	0.120	4a3tB.pdb.gz
17	PDB:7k36A	0.152	0.245	1.484E-2	554	0.053	0.101	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
18	PDB:1b3uA	0.116	0.179	1.750E-2	588	0.059	0.107	1b3uA.pdb.gz
19	PDB:6n1zA	0.179	0.194	1.823E-2	961	0.043	0.048	6n1zA.pdb.gz
20	PDB:6xu2A	0.134	0.132	2.063E-2	1091	0.042	0.041	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG68	0.0	701	876	0.437	0.532	A0A0C4DG68_HUMAN Pumilio RNA binding family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=1
2	A0A0R4IWL6	0.0	1329	1152	0.741	0.686	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
3	C9JW01	0.0	613	293	0.275	1.000	C9JW01_HUMAN Pumilio RNA binding family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=1
4	E9PR38	0.0	1047	944	0.614	0.693	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
5	H0YEH2	0.0	751	1125	0.345	0.327	H0YEH2_HUMAN Pumilio RNA binding family member 1 (Fragment) OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
6	P25822	0.0	589	1533	0.258	0.179	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
7	Q14671	0.0	1368	1186	0.776	0.697	PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3
8	Q5T1Z4	0.0	1379	1189	0.779	0.698	Q5T1Z4_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
9	Q5T1Z8	0.0	1375	1224	0.778	0.677	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
10	Q80U58	0.0	2123	1066	0.977	0.977	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
11	Q80U78	0.0	1357	1189	0.779	0.698	PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus OX=10090 GN=Pum1 PE=1 SV=2
12	Q8TB72	0.0	2188	1066	1.000	1.000	PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2
13	S6B5C2	0.0	1329	1152	0.741	0.686	S6B5C2_DANRE Pumilio1 OS=Danio rerio OX=7955 GN=pum1 PE=2 SV=1
14	Q7SXY5	1.81e-139	432	540	0.279	0.550	Q7SXY5_DANRE Pum1 protein OS=Danio rerio OX=7955 GN=pum1 PE=2 SV=1
15	Q54WA7	1.21e-138	438	785	0.189	0.257	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
16	Q9ZW07	5.24e-132	426	968	0.182	0.200	PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana OX=3702 GN=APUM1 PE=1 SV=1
17	Q9ZW02	1.60e-130	422	964	0.180	0.199	PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana OX=3702 GN=APUM3 PE=1 SV=1
18	Q9ZW06	1.33e-129	420	972	0.180	0.198	PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana OX=3702 GN=APUM2 PE=1 SV=1
19	Q9LJX4	8.27e-122	399	961	0.175	0.195	PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana OX=3702 GN=APUM5 PE=1 SV=2
20	Q9SS47	9.90e-122	400	1003	0.174	0.185	PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana OX=3702 GN=APUM4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08144 CPL	18	17.2	CPL (NUC119) domain
2	PF02318 FYVE_2	1.5e+02	13.9	FYVE-type zinc finger
3	PF02229 PC4	87	14.1	Transcriptional Coactivator p15 (PC4)
4	PF00806 PUF	1.3e-81	278.7	Pumilio-family RNA binding repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008950607.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003817549.1	0.883	Nanos C2HC-type zinc finger 2
2	9597.XP_008973561.1	0.858	Thyroid hormone receptor interactor 12
3	9597.XP_003823218.1	0.826	Ataxin 1
4	9597.XP_003829553.1	0.813	Ataxin-1-like
5	9597.XP_003814897.1	0.791	Nanos C2HC-type zinc finger 3
6	9597.XP_003806697.1	0.784	NIPBL, cohesin loading factor
7	9597.XP_003823705.1	0.781	CCR4-NOT transcription complex subunit 7
8	9597.XP_003829010.1	0.781	CCR4-NOT transcription complex subunit 8 isoform X1
9	9597.XP_003825366.1	0.760	Boule homolog, RNA binding protein
10	9597.XP_008949907.1	0.753	Deleted in azoospermia like
11	9597.XP_008975601.1	0.750	CCR4-NOT transcription complex subunit 1
12	9597.XP_003815349.1	0.736	Cytoplasmic polyadenylation element binding protein 1
13	9597.XP_003806864.1	0.735	Fragile X mental retardation 1
14	9597.XP_003825200.1	0.728	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 186 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
15	9597.XP_008962093.1	0.722	Uncharacterized protein LOC100981370
16	9597.XP_008955924.1	0.720	CCR4-NOT transcription complex subunit 6 like
17	9597.XP_008949572.1	0.716	Binds the poly(A) tail of mRNA.
18	9597.XP_003823171.1	0.702	Stromal antigen 2
19	9597.XP_008954990.1	0.700	CCR4-NOT transcription complex subunit 6
20	9597.XP_003824558.1	0.698	EDAR associated death domain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	0.999	mRNA binding
GO:0003730	0.914	mRNA 3'-UTR binding
GO:0061980	0.772	regulatory RNA binding
GO:0035198	0.682	miRNA binding
GO:0062104	0.570	pumilio-response element binding
GO:0106222	0.552	lncRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0008152	0.980	metabolic process
GO:0019222	0.975	regulation of metabolic process
GO:0051252	0.965	regulation of RNA metabolic process
GO:1903311	0.963	regulation of mRNA metabolic process
GO:0048518	0.954	positive regulation of biological process
GO:0048519	0.953	negative regulation of biological process
GO:0044237	0.940	cellular metabolic process
GO:0010605	0.937	negative regulation of macromolecule metabolic process
GO:0071840	0.934	cellular component organization or biogenesis
GO:0010468	0.934	regulation of gene expression
GO:0010608	0.921	post-transcriptional regulation of gene expression
GO:0071704	0.904	organic substance metabolic process
GO:0044238	0.882	primary metabolic process
GO:0010629	0.871	negative regulation of gene expression
GO:0006807	0.839	nitrogen compound metabolic process
GO:0016043	0.792	cellular component organization
GO:0009894	0.734	regulation of catabolic process
GO:0043170	0.685	macromolecule metabolic process
GO:0034641	0.654	cellular nitrogen compound metabolic process
GO:0048522	0.650	positive regulation of cellular process
GO:1901360	0.606	organic cyclic compound metabolic process
GO:0046483	0.572	heterocycle metabolic process
GO:0006725	0.572	cellular aromatic compound metabolic process
GO:0031329	0.553	regulation of cellular catabolic process
GO:0065008	0.523	regulation of biological quality
GO:0061013	0.509	regulation of mRNA catabolic process
GO:0048583	0.485	regulation of response to stimulus
GO:0048523	0.465	negative regulation of cellular process
GO:0009893	0.446	positive regulation of metabolic process
GO:0010556	0.442	regulation of macromolecule biosynthetic process
GO:0031326	0.442	regulation of cellular biosynthetic process
GO:0043487	0.441	regulation of RNA stability
GO:0010604	0.436	positive regulation of macromolecule metabolic process
GO:0043488	0.417	regulation of mRNA stability
GO:0051246	0.399	regulation of protein metabolic process
GO:0051172	0.376	negative regulation of nitrogen compound metabolic process
GO:0090304	0.373	nucleic acid metabolic process
GO:0032502	0.353	developmental process
GO:0051173	0.343	positive regulation of nitrogen compound metabolic process
GO:0032501	0.311	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.989	cytosol
GO:0070013	0.976	intracellular organelle lumen
GO:0031981	0.964	nuclear lumen
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0016020	0.941	membrane
GO:0005654	0.914	nucleoplasm
GO:0099080	0.912	supramolecular complex
GO:0012505	0.647	endomembrane system
GO:0035770	0.642	ribonucleoprotein granule
GO:0036464	0.610	cytoplasmic ribonucleoprotein granule
GO:0010494	0.577	cytoplasmic stress granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]