StarFunc result for job id Q8TB92

User Input

>input (370 residues)
MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQTSLLTNLHCFQPDVSGFSVSLAGT
VACIHWETSQLSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTS
FVSSRWVPQMADHTEVMKGIHQYPGVRYPVLTPNLQGFHHAVAAGATEISVFGAASESFS
KKNINCSIEESMGKFEEVVKSARHMNIPARGYVSCALGCPYEGSITPQKVTEVSKRLYGM
GCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINV
VDSAVSGLGGCPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDFICKAVNKTTN
SKVAQASFNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TB92	1.000	1.000	1.039E-76	370	1.000	1.000	Q8TB92.pdb.gz	HMGC2_HUMAN 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCLL1 PE=1 SV=3
2	AFDB:P35914	0.809	0.920	1.335E-53	325	0.589	0.671	P35914.pdb.gz	HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCL PE=1 SV=2
3	AFDB:P35915	0.800	0.992	3.305E-53	298	0.581	0.721	P35915.pdb.gz	HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus OX=9031 GN=HMGCL PE=1 SV=1
4	AFDB:P38060	0.810	0.922	7.254E-53	325	0.584	0.665	P38060.pdb.gz	HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcl PE=1 SV=2
5	AFDB:O81027	0.796	0.630	2.407E-50	468	0.535	0.423	O81027.pdb.gz	HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HMGCL PE=1 SV=2
6	PDB:2cw6A	0.787	0.983	1.481E-49	296	0.573	0.716	2cw6A.pdb.gz	Crystal structure of human 3-hydroxy-3-methylglutaryl-CoA Lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria
7	AFDB:Q9I2A0	0.794	0.978	3.409E-47	300	0.438	0.540	Q9I2A0.pdb.gz	LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuE PE=1 SV=1
8	PDB:2ftpA	0.792	0.975	2.985E-44	300	0.438	0.540	2ftpA.pdb.gz
9	AFDB:Q5B2F7	0.786	0.489	2.399E-37	599	0.351	0.217	Q5B2F7.pdb.gz	Q5B2F7_EMENI hydroxymethylglutaryl-CoA lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05273 PE=3 SV=1
10	AFDB:A9WGE2	0.750	0.871	3.995E-30	317	0.265	0.309	A9WGE2.pdb.gz	CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) OX=324602 GN=ccl PE=1 SV=1
11	AFDB:D6XFK6	0.698	0.603	2.528E-23	431	0.243	0.209	D6XFK6.pdb.gz	D6XFK6_TRYB2 hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1420 PE=3 SV=1
12	AFDB:Q9C550	0.616	0.374	2.196E-19	631	0.200	0.117	Q9C550.pdb.gz	LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPMS2 PE=1 SV=1
13	PDB:1nvmA	0.582	0.630	3.104E-15	340	0.157	0.171	1nvmA.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
14	PDB:3ivtB	0.596	0.554	2.023E-14	400	0.149	0.138	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
15	PDB:4jn6C	0.622	0.675	5.654E-14	339	0.149	0.162	4jn6C.pdb.gz	Characterization of an Aldolase-Dehydrogenase Complex from the Cholesterol Degradation Pathway of Mycobacterium tuberculosis.
16	PDB:3ho8D	0.593	0.252	9.081E-12	934	0.130	0.051	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
17	PDB:3bg5A	0.590	0.209	2.538E-11	1137	0.138	0.045	3bg5A.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
18	PDB:3figB	0.615	0.409	4.647E-11	577	0.132	0.085	3figB.pdb.gz	Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis.
19	PDB:3bg5B	0.591	0.220	1.299E-10	1074	0.143	0.049	3bg5B.pdb.gz	Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction.
20	PDB:4hnvB	0.565	0.218	1.380E-10	1033	0.151	0.054	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TB92	0.0	767	370	1.000	1.000	HMGC2_HUMAN 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCLL1 PE=1 SV=3
2	P35915	1.52e-165	466	298	0.581	0.721	HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus OX=9031 GN=HMGCL PE=1 SV=1
3	P97519	8.26e-165	465	325	0.581	0.662	HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hmgcl PE=2 SV=1
4	P35914	4.08e-164	464	325	0.584	0.665	HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCL PE=1 SV=2
5	P38060	2.83e-163	461	325	0.584	0.665	HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcl PE=1 SV=2
6	O81027	6.74e-135	395	468	0.532	0.421	HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HMGCL PE=1 SV=2
7	Q9I2A0	9.61e-119	347	300	0.432	0.533	LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuE PE=1 SV=1
8	Q5B2F7	7.24e-84	268	599	0.351	0.217	Q5B2F7_EMENI hydroxymethylglutaryl-CoA lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05273 PE=3 SV=1
9	A9WGE2	1.12e-58	194	317	0.268	0.312	CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) OX=324602 GN=ccl PE=1 SV=1
10	D6XFK6	8.73e-30	120	431	0.235	0.202	D6XFK6_TRYB2 hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.1420 PE=3 SV=1
11	Q583A8	8.73e-30	120	431	0.235	0.202	Q583A8_9TRYP hydroxymethylglutaryl-CoA lyase OS=Trypanosoma brucei OX=5691 GN=Tb04.4J6.180 PE=3 SV=1
12	Q57926	9.95e-10	62.0	406	0.203	0.185	AKSA_METJA Homocitrate synthase AksA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=aksA PE=1 SV=3
13	F1QYZ6	2.41e-07	55.1	1181	0.103	0.032	F1QYZ6_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCb PE=1 SV=1
14	Q9FN52	2.48e-07	54.7	503	0.168	0.123	MAM3_ARATH Methylthioalkylmalate synthase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MAM3 PE=1 SV=1
15	Q9FG67	1.65e-06	52.0	506	0.186	0.136	MAM1_ARATH Methylthioalkylmalate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MAM1 PE=1 SV=1
16	P09151	3.23e-06	51.2	523	0.105	0.075	LEU1_ECOLI 2-isopropylmalate synthase OS=Escherichia coli (strain K12) OX=83333 GN=leuA PE=1 SV=5
17	A0A0R4IFJ4	7.86e-06	50.4	1181	0.100	0.031	A0A0R4IFJ4_DANRE Pyruvate carboxylase OS=Danio rerio OX=7955 GN=PYCa PE=1 SV=1
18	Q9C550	1.15e-05	49.7	631	0.176	0.103	LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPMS2 PE=1 SV=1
19	P11154	1.61e-05	49.3	1178	0.081	0.025	PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PYC1 PE=1 SV=2
20	Q9Y823	2.14e-05	48.5	418	0.157	0.139	HOSM_SCHPO Homocitrate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lys4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00682 HMGL-like	1.7e-62	223.0	HMGL-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381654

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333664	0.964	3-ketoacyl-CoA thiolase, peroxisomal
2	9606.ENSP00000285093	0.957	3-ketoacyl-CoA thiolase, mitochondrial
3	9606.ENSP00000364883	0.955	Methylglutaconyl-CoA hydratase, mitochondrial
4	9606.ENSP00000196371	0.943	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
5	9606.ENSP00000356015	0.942	Acetyl-CoA acetyltransferase, cytosolic
6	9606.ENSP00000265838	0.941	Acetyl-CoA acetyltransferase, mitochondrial
7	9606.ENSP00000325136	0.936	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
8	9606.ENSP00000358414	0.926	Hydroxymethylglutaryl-CoA synthase, mitochondrial
9	9606.ENSP00000322706	0.924	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
10	9606.ENSP00000361914	0.923	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
11	9606.ENSP00000376184	0.923	D-beta-hydroxybutyrate dehydrogenase, mitochondrial
12	9606.ENSP00000324842	0.915	Acetoacetyl-CoA synthetase
13	9606.ENSP00000296424	0.908	3-hydroxybutyrate dehydrogenase type 2
14	9606.ENSP00000377446	0.846	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
15	9606.ENSP00000367923	0.845	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
16	9606.ENSP00000363614	0.844	Hydroxymethylglutaryl-CoA lyase, mitochondrial
17	9606.ENSP00000342056	0.843	Citrate synthase, mitochondrial
18	9606.ENSP00000419325	0.838	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
19	9606.ENSP00000253792	0.836	ATP-citrate synthase
20	9606.ENSP00000280346	0.834	Dihydrolipoamide S-acetyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004419	0.997	hydroxymethylglutaryl-CoA lyase activity
GO:0043167	0.963	ion binding
GO:0043169	0.867	cation binding
GO:0005515	0.856	protein binding
GO:0046872	0.691	metal ion binding
GO:0016740	0.543	transferase activity
GO:0016746	0.340	acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006629	0.991	lipid metabolic process
GO:0044249	0.983	cellular biosynthetic process
GO:0006091	0.981	generation of precursor metabolites and energy
GO:0044281	0.972	small molecule metabolic process
GO:1901570	0.971	fatty acid derivative biosynthetic process
GO:0044283	0.957	small molecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0012505	0.971	endomembrane system
GO:0016020	0.957	membrane
GO:0005739	0.923	mitochondrion
GO:0043233	0.671	organelle lumen
GO:0070013	0.658	intracellular organelle lumen
GO:0005783	0.618	endoplasmic reticulum
GO:0048471	0.425	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24404	0.997	(3S)-hydroxy-3-methylglutaryl-CoA = acetoacetate + acetyl-CoA
EC:4.1.3.4	0.997	hydroxymethylglutaryl-CoA lyase.
EC:2.-.-.-	0.543	Transferases.
EC:2.3.-.-	0.340	Acyltransferases.

[back to server]